Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8UTW3

Protein Details
Accession A0A1V8UTW3    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
7-30WPIWVSGKPSKKPTKGKDDSLRDSHydrophilic
33-61AVSTLNKKPSTRKPARKRGKPTPQKDDDDHydrophilic
NLS Segment(s)
PositionSequence
39-53KKPSTRKPARKRGKP
Subcellular Location(s) nucl 16.5, cyto_nucl 9, mito 8
Family & Domain DBs
Amino Acid Sequences MEASRMWPIWVSGKPSKKPTKGKDDSLRDSLAAVSTLNKKPSTRKPARKRGKPTPQKDDDDDDALFVKRIKKEPMFSTPKKLNPAKPPAFINLDTPLPIHRASRQSSTELSEVDEEAFHANGGESHNESKTTDAELDEDLLDDPLQMPPQPQKRYIAPSDRELRGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.57
3 0.66
4 0.69
5 0.76
6 0.78
7 0.8
8 0.79
9 0.83
10 0.83
11 0.83
12 0.79
13 0.74
14 0.66
15 0.54
16 0.48
17 0.38
18 0.28
19 0.19
20 0.13
21 0.12
22 0.17
23 0.21
24 0.24
25 0.25
26 0.27
27 0.34
28 0.44
29 0.52
30 0.56
31 0.64
32 0.71
33 0.8
34 0.89
35 0.91
36 0.9
37 0.9
38 0.91
39 0.9
40 0.88
41 0.87
42 0.84
43 0.79
44 0.72
45 0.67
46 0.58
47 0.5
48 0.41
49 0.31
50 0.25
51 0.2
52 0.18
53 0.14
54 0.16
55 0.16
56 0.19
57 0.24
58 0.26
59 0.3
60 0.34
61 0.42
62 0.46
63 0.45
64 0.49
65 0.49
66 0.49
67 0.52
68 0.52
69 0.49
70 0.48
71 0.56
72 0.52
73 0.5
74 0.47
75 0.43
76 0.42
77 0.37
78 0.31
79 0.23
80 0.2
81 0.17
82 0.16
83 0.14
84 0.12
85 0.12
86 0.11
87 0.13
88 0.18
89 0.21
90 0.26
91 0.27
92 0.27
93 0.28
94 0.3
95 0.27
96 0.23
97 0.21
98 0.17
99 0.15
100 0.13
101 0.11
102 0.08
103 0.08
104 0.08
105 0.06
106 0.06
107 0.05
108 0.06
109 0.08
110 0.09
111 0.1
112 0.12
113 0.13
114 0.14
115 0.15
116 0.15
117 0.15
118 0.15
119 0.14
120 0.13
121 0.13
122 0.13
123 0.14
124 0.12
125 0.12
126 0.1
127 0.09
128 0.09
129 0.07
130 0.08
131 0.08
132 0.09
133 0.09
134 0.12
135 0.2
136 0.3
137 0.34
138 0.36
139 0.4
140 0.46
141 0.53
142 0.59
143 0.6
144 0.55
145 0.59
146 0.64
147 0.64