Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NTE1

Protein Details
Accession G9NTE1   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
52-75AEKDTRSSPRCRSKRNPQNATPAWHydrophilic
121-142AKEHIGKQRRKLRKRMSFIKVKBasic
NLS Segment(s)
PositionSequence
126-136GKQRRKLRKRM
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
Amino Acid Sequences MEPITISEKSVRGLGRDLSPASSSPSSRRANSFDSRSSMSTLSTSRGSSPDAEKDTRSSPRCRSKRNPQNATPAWNLMFQPRSYEDIYSERAYLTASLQRHSLTAIELIHQYSLIEEELDAKEHIGKQRRKLRKRMSFIKVKLAEAARQEKAIIIRLGELQMEQLGRDTWDQVQQRRMFYPLAPSPMPRTTPLNAGSRKFVPSENRSEISQEHIQLCPSDMAKPRVLDTVVEVQEGEEEDTNEIANNTEEETESRSETDTESEDLCNHGLEYTYQKSDNATEISQLRPSHVRERLSSCLEEKRMSLPTLSFVWPGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.3
4 0.3
5 0.27
6 0.28
7 0.26
8 0.28
9 0.28
10 0.27
11 0.27
12 0.35
13 0.38
14 0.4
15 0.44
16 0.43
17 0.47
18 0.53
19 0.55
20 0.5
21 0.5
22 0.5
23 0.46
24 0.44
25 0.38
26 0.3
27 0.27
28 0.23
29 0.22
30 0.2
31 0.2
32 0.19
33 0.2
34 0.21
35 0.21
36 0.24
37 0.28
38 0.32
39 0.33
40 0.33
41 0.34
42 0.38
43 0.44
44 0.44
45 0.44
46 0.48
47 0.57
48 0.65
49 0.71
50 0.75
51 0.78
52 0.84
53 0.88
54 0.87
55 0.83
56 0.85
57 0.79
58 0.75
59 0.67
60 0.59
61 0.49
62 0.42
63 0.36
64 0.3
65 0.29
66 0.23
67 0.24
68 0.23
69 0.26
70 0.25
71 0.25
72 0.22
73 0.23
74 0.27
75 0.24
76 0.22
77 0.18
78 0.17
79 0.16
80 0.14
81 0.13
82 0.14
83 0.14
84 0.14
85 0.15
86 0.15
87 0.15
88 0.15
89 0.13
90 0.09
91 0.1
92 0.1
93 0.1
94 0.11
95 0.11
96 0.1
97 0.1
98 0.09
99 0.06
100 0.07
101 0.06
102 0.05
103 0.04
104 0.07
105 0.08
106 0.09
107 0.09
108 0.08
109 0.1
110 0.12
111 0.18
112 0.25
113 0.29
114 0.37
115 0.47
116 0.57
117 0.63
118 0.71
119 0.77
120 0.78
121 0.82
122 0.83
123 0.81
124 0.8
125 0.75
126 0.74
127 0.65
128 0.55
129 0.5
130 0.41
131 0.36
132 0.31
133 0.33
134 0.24
135 0.22
136 0.21
137 0.19
138 0.19
139 0.19
140 0.15
141 0.1
142 0.1
143 0.11
144 0.11
145 0.1
146 0.09
147 0.06
148 0.06
149 0.06
150 0.05
151 0.05
152 0.05
153 0.06
154 0.06
155 0.07
156 0.07
157 0.14
158 0.17
159 0.19
160 0.27
161 0.29
162 0.3
163 0.3
164 0.31
165 0.26
166 0.23
167 0.27
168 0.22
169 0.24
170 0.23
171 0.23
172 0.25
173 0.27
174 0.28
175 0.23
176 0.24
177 0.21
178 0.25
179 0.28
180 0.32
181 0.32
182 0.32
183 0.34
184 0.32
185 0.32
186 0.28
187 0.28
188 0.28
189 0.3
190 0.36
191 0.38
192 0.38
193 0.37
194 0.37
195 0.34
196 0.32
197 0.31
198 0.26
199 0.22
200 0.21
201 0.21
202 0.2
203 0.21
204 0.17
205 0.14
206 0.17
207 0.2
208 0.24
209 0.26
210 0.27
211 0.27
212 0.27
213 0.27
214 0.22
215 0.2
216 0.25
217 0.22
218 0.21
219 0.2
220 0.17
221 0.17
222 0.18
223 0.15
224 0.08
225 0.08
226 0.08
227 0.09
228 0.09
229 0.08
230 0.08
231 0.07
232 0.07
233 0.07
234 0.07
235 0.07
236 0.08
237 0.09
238 0.12
239 0.13
240 0.13
241 0.14
242 0.14
243 0.14
244 0.14
245 0.16
246 0.15
247 0.15
248 0.15
249 0.15
250 0.15
251 0.16
252 0.15
253 0.13
254 0.11
255 0.1
256 0.09
257 0.1
258 0.16
259 0.19
260 0.21
261 0.22
262 0.22
263 0.24
264 0.25
265 0.27
266 0.24
267 0.21
268 0.22
269 0.24
270 0.26
271 0.29
272 0.28
273 0.27
274 0.3
275 0.34
276 0.39
277 0.43
278 0.45
279 0.45
280 0.52
281 0.55
282 0.54
283 0.53
284 0.48
285 0.5
286 0.49
287 0.46
288 0.41
289 0.39
290 0.38
291 0.36
292 0.34
293 0.27
294 0.26
295 0.28
296 0.29