Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8TYR0

Protein Details
Accession A0A1V8TYR0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MVYFQRRQRRHPKRKPTVTITDLPHydrophilic
NLS Segment(s)
PositionSequence
8-15QRRHPKRK
Subcellular Location(s) mito 24.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
IPR001810  F-box_dom  
PROSITE View protein in PROSITE  
PS50181  FBOX  
Amino Acid Sequences MVYFQRRQRRHPKRKPTVTITDLPDELILGVLGYLDMDSVLKARVCNQRLLLVCGQAVHSRLKVLYIHPTRLSVRQAVAICNSAWAEGIKEVCLLGRVLWDEMLAEARDAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.94
3 0.91
4 0.89
5 0.83
6 0.79
7 0.72
8 0.64
9 0.53
10 0.44
11 0.35
12 0.26
13 0.19
14 0.13
15 0.08
16 0.04
17 0.03
18 0.03
19 0.03
20 0.03
21 0.02
22 0.02
23 0.02
24 0.02
25 0.03
26 0.03
27 0.05
28 0.06
29 0.06
30 0.13
31 0.21
32 0.22
33 0.25
34 0.25
35 0.3
36 0.3
37 0.34
38 0.28
39 0.21
40 0.19
41 0.17
42 0.17
43 0.13
44 0.13
45 0.1
46 0.1
47 0.1
48 0.09
49 0.11
50 0.11
51 0.11
52 0.19
53 0.21
54 0.24
55 0.24
56 0.27
57 0.28
58 0.3
59 0.31
60 0.23
61 0.21
62 0.23
63 0.24
64 0.22
65 0.22
66 0.2
67 0.18
68 0.17
69 0.16
70 0.11
71 0.11
72 0.09
73 0.09
74 0.1
75 0.1
76 0.09
77 0.09
78 0.09
79 0.09
80 0.1
81 0.09
82 0.07
83 0.1
84 0.11
85 0.12
86 0.12
87 0.12
88 0.11
89 0.11
90 0.14
91 0.11