Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8U017

Protein Details
Accession A0A1V8U017    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
117-136TGEVRMKRRKMKPTHMERTIBasic
NLS Segment(s)
Subcellular Location(s) cysk 12, cyto 8.5, cyto_nucl 6, mito 3, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003010  C-N_Hydrolase  
IPR036526  C-N_Hydrolase_sf  
IPR044149  Nitrilases_CHs  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0006807  P:nitrogen compound metabolic process  
Pfam View protein in Pfam  
PF00795  CN_hydrolase  
PROSITE View protein in PROSITE  
PS50263  CN_HYDROLASE  
CDD cd07564  nitrilases_CHs  
Amino Acid Sequences MPSKTVRVAVTQHEPIWLDISATIAKTCSLIAEAASTKATLIVFPECWIPGYPAWIWSRPVDFDLGVKYVENSLRIDSPEMRQICDAAAEHGINVGLGFSERDGESVYISQALISETGEVRMKRRKMKPTHMERTIFGDASGDCLASVVQLPDDGPRVGSLSCWEHIQPLLKYYTLSQQEQIHIAAWPPLDPFVDGSPGFWSMSEQGCRNLSQTYAAEAGAFVLHCTAVLSQPGIDAMKTAGSPIMGSPVAGSSAIIGPDGRILKAAESGSEQLIIADLDMALVTKTKTFADAGGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.32
3 0.31
4 0.25
5 0.18
6 0.14
7 0.16
8 0.14
9 0.13
10 0.13
11 0.11
12 0.11
13 0.11
14 0.1
15 0.08
16 0.08
17 0.08
18 0.08
19 0.11
20 0.12
21 0.13
22 0.14
23 0.13
24 0.11
25 0.13
26 0.13
27 0.09
28 0.1
29 0.12
30 0.12
31 0.13
32 0.15
33 0.13
34 0.15
35 0.15
36 0.16
37 0.13
38 0.17
39 0.16
40 0.2
41 0.23
42 0.24
43 0.25
44 0.25
45 0.27
46 0.24
47 0.25
48 0.21
49 0.18
50 0.17
51 0.18
52 0.16
53 0.14
54 0.13
55 0.12
56 0.14
57 0.15
58 0.15
59 0.13
60 0.14
61 0.16
62 0.17
63 0.19
64 0.18
65 0.19
66 0.25
67 0.25
68 0.24
69 0.22
70 0.22
71 0.19
72 0.19
73 0.17
74 0.11
75 0.12
76 0.11
77 0.1
78 0.1
79 0.1
80 0.08
81 0.07
82 0.05
83 0.03
84 0.03
85 0.04
86 0.03
87 0.05
88 0.05
89 0.06
90 0.07
91 0.07
92 0.08
93 0.08
94 0.08
95 0.07
96 0.07
97 0.07
98 0.06
99 0.06
100 0.06
101 0.05
102 0.06
103 0.05
104 0.07
105 0.1
106 0.1
107 0.14
108 0.21
109 0.26
110 0.34
111 0.42
112 0.51
113 0.56
114 0.67
115 0.73
116 0.76
117 0.8
118 0.78
119 0.72
120 0.63
121 0.61
122 0.52
123 0.42
124 0.31
125 0.23
126 0.16
127 0.16
128 0.16
129 0.09
130 0.07
131 0.07
132 0.07
133 0.06
134 0.06
135 0.03
136 0.03
137 0.03
138 0.04
139 0.05
140 0.06
141 0.06
142 0.06
143 0.06
144 0.07
145 0.07
146 0.07
147 0.08
148 0.09
149 0.1
150 0.11
151 0.11
152 0.1
153 0.12
154 0.16
155 0.14
156 0.14
157 0.15
158 0.14
159 0.14
160 0.15
161 0.21
162 0.2
163 0.21
164 0.22
165 0.23
166 0.24
167 0.25
168 0.24
169 0.18
170 0.14
171 0.13
172 0.12
173 0.1
174 0.09
175 0.08
176 0.08
177 0.08
178 0.08
179 0.09
180 0.08
181 0.11
182 0.1
183 0.11
184 0.11
185 0.12
186 0.12
187 0.1
188 0.11
189 0.1
190 0.14
191 0.16
192 0.16
193 0.18
194 0.19
195 0.2
196 0.2
197 0.18
198 0.15
199 0.16
200 0.16
201 0.15
202 0.15
203 0.14
204 0.13
205 0.12
206 0.12
207 0.08
208 0.08
209 0.05
210 0.05
211 0.04
212 0.04
213 0.05
214 0.05
215 0.06
216 0.07
217 0.08
218 0.07
219 0.08
220 0.09
221 0.09
222 0.08
223 0.07
224 0.07
225 0.08
226 0.08
227 0.08
228 0.07
229 0.07
230 0.08
231 0.07
232 0.11
233 0.09
234 0.09
235 0.09
236 0.09
237 0.1
238 0.09
239 0.09
240 0.07
241 0.08
242 0.09
243 0.09
244 0.08
245 0.07
246 0.12
247 0.14
248 0.12
249 0.12
250 0.13
251 0.13
252 0.17
253 0.17
254 0.14
255 0.16
256 0.18
257 0.17
258 0.17
259 0.16
260 0.12
261 0.12
262 0.11
263 0.08
264 0.06
265 0.05
266 0.05
267 0.05
268 0.05
269 0.04
270 0.06
271 0.07
272 0.08
273 0.09
274 0.1
275 0.12
276 0.13