Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9P220

Protein Details
Accession G9P220    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
130-149VMRLSDIWRRRKKNKCSDLAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MGNMRQGMFPTCHQSSRLFLVEGDESVEQQDTTDDNEINPVTQTDSQQGGNLNMDGKVIQAGRFDNTSSETDRDAMLRTLLETADMAESGEHEEMEDEELNMLPTRNDDELVTFQKLCPLRQKEPTQQPVMRLSDIWRRRKKNKCSDLALDDLRYTISKVIDVFVQTCSSEGYGQMMPSISLEEEFIPPFACAVKLGDANLVRLLLWNEANANVGYRDLYACLMVKDVKFGGAFFLAHLYKAVKKRSPLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.36
4 0.36
5 0.29
6 0.26
7 0.27
8 0.26
9 0.24
10 0.22
11 0.16
12 0.14
13 0.14
14 0.14
15 0.1
16 0.09
17 0.1
18 0.08
19 0.11
20 0.14
21 0.13
22 0.12
23 0.16
24 0.16
25 0.15
26 0.15
27 0.13
28 0.13
29 0.15
30 0.16
31 0.17
32 0.19
33 0.18
34 0.2
35 0.21
36 0.19
37 0.18
38 0.17
39 0.15
40 0.13
41 0.13
42 0.11
43 0.09
44 0.1
45 0.1
46 0.1
47 0.11
48 0.12
49 0.13
50 0.14
51 0.15
52 0.13
53 0.15
54 0.17
55 0.17
56 0.18
57 0.17
58 0.17
59 0.17
60 0.16
61 0.15
62 0.13
63 0.11
64 0.1
65 0.09
66 0.09
67 0.09
68 0.08
69 0.06
70 0.07
71 0.06
72 0.06
73 0.06
74 0.04
75 0.05
76 0.06
77 0.06
78 0.05
79 0.05
80 0.05
81 0.06
82 0.08
83 0.07
84 0.06
85 0.06
86 0.06
87 0.07
88 0.07
89 0.07
90 0.05
91 0.05
92 0.08
93 0.08
94 0.08
95 0.08
96 0.09
97 0.13
98 0.15
99 0.16
100 0.14
101 0.13
102 0.18
103 0.19
104 0.19
105 0.25
106 0.28
107 0.31
108 0.39
109 0.45
110 0.49
111 0.57
112 0.61
113 0.58
114 0.53
115 0.52
116 0.49
117 0.45
118 0.36
119 0.28
120 0.25
121 0.28
122 0.34
123 0.42
124 0.45
125 0.5
126 0.6
127 0.7
128 0.77
129 0.8
130 0.81
131 0.79
132 0.76
133 0.74
134 0.68
135 0.62
136 0.53
137 0.43
138 0.33
139 0.26
140 0.2
141 0.15
142 0.12
143 0.09
144 0.08
145 0.08
146 0.09
147 0.09
148 0.1
149 0.1
150 0.11
151 0.1
152 0.1
153 0.09
154 0.09
155 0.09
156 0.09
157 0.08
158 0.08
159 0.1
160 0.09
161 0.09
162 0.1
163 0.1
164 0.09
165 0.09
166 0.09
167 0.06
168 0.06
169 0.07
170 0.07
171 0.08
172 0.09
173 0.09
174 0.09
175 0.08
176 0.08
177 0.08
178 0.07
179 0.07
180 0.08
181 0.11
182 0.11
183 0.12
184 0.16
185 0.16
186 0.17
187 0.17
188 0.16
189 0.13
190 0.14
191 0.14
192 0.12
193 0.12
194 0.11
195 0.11
196 0.12
197 0.13
198 0.12
199 0.12
200 0.1
201 0.1
202 0.1
203 0.09
204 0.1
205 0.09
206 0.1
207 0.1
208 0.11
209 0.11
210 0.13
211 0.15
212 0.15
213 0.17
214 0.17
215 0.18
216 0.17
217 0.17
218 0.17
219 0.15
220 0.15
221 0.12
222 0.18
223 0.15
224 0.15
225 0.17
226 0.17
227 0.22
228 0.29
229 0.37
230 0.37