Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V8V0P3

Protein Details
Accession A0A1V8V0P3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
22-47APAATGGKKQKKKWSKGKVKDKAVHAHydrophilic
NLS Segment(s)
PositionSequence
27-43GGKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 13.5, mito 10, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MDKYGSSAEPAVSRRVMLRGYAPAATGGKKQKKKWSKGKVKDKAVHAVTFDKATGEKLAKDVQSYRLVTVAVLVDRLKINGSLARQALKDLEEKGTIKKVVGHSSGNIYTRAVGGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.22
4 0.19
5 0.2
6 0.2
7 0.22
8 0.22
9 0.2
10 0.2
11 0.2
12 0.2
13 0.23
14 0.28
15 0.36
16 0.42
17 0.48
18 0.57
19 0.66
20 0.74
21 0.79
22 0.81
23 0.83
24 0.86
25 0.91
26 0.9
27 0.9
28 0.86
29 0.79
30 0.76
31 0.67
32 0.57
33 0.48
34 0.4
35 0.31
36 0.25
37 0.21
38 0.13
39 0.11
40 0.11
41 0.11
42 0.09
43 0.09
44 0.1
45 0.12
46 0.12
47 0.13
48 0.14
49 0.16
50 0.21
51 0.21
52 0.2
53 0.18
54 0.18
55 0.16
56 0.16
57 0.12
58 0.07
59 0.08
60 0.07
61 0.08
62 0.08
63 0.09
64 0.08
65 0.07
66 0.09
67 0.1
68 0.12
69 0.15
70 0.16
71 0.18
72 0.17
73 0.18
74 0.18
75 0.17
76 0.18
77 0.16
78 0.17
79 0.19
80 0.2
81 0.22
82 0.27
83 0.26
84 0.24
85 0.27
86 0.29
87 0.32
88 0.35
89 0.34
90 0.3
91 0.36
92 0.4
93 0.36
94 0.32
95 0.26
96 0.23