Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V8TCX1

Protein Details
Accession A0A1V8TCX1    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
70-92YAGAPRSPGKREPPRRPRGMSESHydrophilic
109-143DRPPRTESEERRRRERRREREERHKREKEKVRAGABasic
NLS Segment(s)
PositionSequence
69-150PYAGAPRSPGKREPPRRPRGMSESSVMDKERDIRRERERADRPPRTESEERRRRERRREREERHKREKEKVRAGAGGARMKK
438-443KGGRRA
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013226  Pal1  
Pfam View protein in Pfam  
PF08316  Pal1  
Amino Acid Sequences MAMERFQRWREAFADFYSPQNDLSLLDKDGNGTSVTRAPPPRAGTLPVNGSRQAAPAGSSSRPNGPPPPYAGAPRSPGKREPPRRPRGMSESSVMDKERDIRRERERADRPPRTESEERRRRERRREREERHKREKEKVRAGAGGARMKKPQGLDIIDQLDVTGIYGQGLFHHDGPFDACNPHRNHHKARGPAPMQAFPANSANMALGGSGPLNSRIDLDRFHGRGEEAFEAFTTTRKPQPAVVDPTARAEPVHGEETVGLGTSTFLEGAPASRRDLQRRDSEDVSQMTGGAMGGGLSRKKSIAQRFRGMSNTRRTPVGDNYRSPDARYDLQDGQMNHLGAQSAGGPVRAKYTRDNEINPFDNDYENAYEKKGAQIKIAESESRPLVAKTSPPRVGGASVLTRSVTADSGALRPGSGNGEEGKSSGGGGFLNRMKSLKGGRRARLDRGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.32
3 0.34
4 0.32
5 0.3
6 0.26
7 0.24
8 0.22
9 0.15
10 0.18
11 0.17
12 0.17
13 0.18
14 0.18
15 0.19
16 0.19
17 0.19
18 0.16
19 0.14
20 0.15
21 0.18
22 0.2
23 0.26
24 0.29
25 0.32
26 0.37
27 0.4
28 0.43
29 0.4
30 0.43
31 0.4
32 0.42
33 0.45
34 0.44
35 0.43
36 0.39
37 0.38
38 0.34
39 0.31
40 0.27
41 0.2
42 0.17
43 0.17
44 0.19
45 0.19
46 0.22
47 0.23
48 0.29
49 0.31
50 0.34
51 0.38
52 0.38
53 0.4
54 0.42
55 0.45
56 0.4
57 0.42
58 0.42
59 0.39
60 0.4
61 0.43
62 0.44
63 0.43
64 0.47
65 0.52
66 0.6
67 0.66
68 0.72
69 0.76
70 0.8
71 0.85
72 0.84
73 0.81
74 0.79
75 0.75
76 0.67
77 0.59
78 0.54
79 0.48
80 0.45
81 0.38
82 0.3
83 0.24
84 0.28
85 0.32
86 0.34
87 0.36
88 0.42
89 0.5
90 0.58
91 0.61
92 0.64
93 0.65
94 0.69
95 0.75
96 0.76
97 0.72
98 0.7
99 0.69
100 0.67
101 0.67
102 0.66
103 0.67
104 0.67
105 0.67
106 0.7
107 0.78
108 0.79
109 0.82
110 0.83
111 0.83
112 0.85
113 0.91
114 0.9
115 0.92
116 0.94
117 0.93
118 0.93
119 0.92
120 0.86
121 0.85
122 0.86
123 0.85
124 0.84
125 0.79
126 0.71
127 0.63
128 0.59
129 0.53
130 0.48
131 0.44
132 0.37
133 0.33
134 0.31
135 0.29
136 0.31
137 0.27
138 0.25
139 0.24
140 0.24
141 0.23
142 0.26
143 0.27
144 0.25
145 0.24
146 0.2
147 0.14
148 0.11
149 0.09
150 0.06
151 0.04
152 0.04
153 0.04
154 0.04
155 0.05
156 0.08
157 0.09
158 0.1
159 0.1
160 0.1
161 0.1
162 0.12
163 0.12
164 0.11
165 0.12
166 0.12
167 0.19
168 0.21
169 0.25
170 0.32
171 0.38
172 0.43
173 0.5
174 0.56
175 0.55
176 0.57
177 0.63
178 0.55
179 0.54
180 0.51
181 0.43
182 0.39
183 0.34
184 0.29
185 0.21
186 0.21
187 0.16
188 0.13
189 0.11
190 0.09
191 0.08
192 0.07
193 0.05
194 0.03
195 0.04
196 0.04
197 0.04
198 0.04
199 0.06
200 0.06
201 0.06
202 0.08
203 0.09
204 0.1
205 0.1
206 0.13
207 0.17
208 0.18
209 0.18
210 0.17
211 0.16
212 0.16
213 0.18
214 0.16
215 0.1
216 0.1
217 0.09
218 0.1
219 0.1
220 0.1
221 0.1
222 0.1
223 0.14
224 0.15
225 0.16
226 0.18
227 0.23
228 0.29
229 0.33
230 0.34
231 0.34
232 0.33
233 0.34
234 0.32
235 0.26
236 0.2
237 0.13
238 0.12
239 0.12
240 0.13
241 0.1
242 0.1
243 0.1
244 0.1
245 0.1
246 0.08
247 0.05
248 0.04
249 0.04
250 0.04
251 0.04
252 0.04
253 0.04
254 0.04
255 0.04
256 0.06
257 0.09
258 0.1
259 0.12
260 0.18
261 0.21
262 0.27
263 0.33
264 0.36
265 0.41
266 0.46
267 0.49
268 0.46
269 0.44
270 0.43
271 0.38
272 0.34
273 0.25
274 0.2
275 0.14
276 0.12
277 0.1
278 0.05
279 0.04
280 0.03
281 0.04
282 0.05
283 0.06
284 0.07
285 0.08
286 0.08
287 0.12
288 0.2
289 0.29
290 0.38
291 0.44
292 0.51
293 0.53
294 0.55
295 0.59
296 0.56
297 0.54
298 0.53
299 0.53
300 0.47
301 0.46
302 0.45
303 0.43
304 0.47
305 0.5
306 0.46
307 0.43
308 0.46
309 0.51
310 0.5
311 0.46
312 0.41
313 0.34
314 0.32
315 0.32
316 0.33
317 0.28
318 0.31
319 0.34
320 0.3
321 0.31
322 0.32
323 0.28
324 0.23
325 0.22
326 0.19
327 0.14
328 0.14
329 0.1
330 0.08
331 0.08
332 0.09
333 0.09
334 0.09
335 0.16
336 0.18
337 0.19
338 0.25
339 0.3
340 0.37
341 0.42
342 0.46
343 0.46
344 0.5
345 0.52
346 0.46
347 0.44
348 0.36
349 0.32
350 0.28
351 0.25
352 0.22
353 0.21
354 0.2
355 0.18
356 0.19
357 0.19
358 0.26
359 0.29
360 0.27
361 0.28
362 0.32
363 0.33
364 0.37
365 0.39
366 0.34
367 0.29
368 0.32
369 0.29
370 0.26
371 0.25
372 0.19
373 0.19
374 0.18
375 0.25
376 0.29
377 0.37
378 0.39
379 0.4
380 0.41
381 0.4
382 0.4
383 0.34
384 0.31
385 0.26
386 0.23
387 0.23
388 0.21
389 0.2
390 0.19
391 0.19
392 0.14
393 0.1
394 0.11
395 0.12
396 0.13
397 0.15
398 0.14
399 0.13
400 0.13
401 0.14
402 0.16
403 0.15
404 0.15
405 0.16
406 0.18
407 0.18
408 0.18
409 0.18
410 0.14
411 0.14
412 0.12
413 0.1
414 0.09
415 0.09
416 0.16
417 0.18
418 0.21
419 0.22
420 0.23
421 0.23
422 0.28
423 0.37
424 0.4
425 0.46
426 0.53
427 0.59
428 0.69
429 0.74