Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9P0F4

Protein Details
Accession G9P0F4    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
83-104TPVKTPRKRGPQLAKKKTPKAIHydrophilic
NLS Segment(s)
PositionSequence
86-102KTPRKRGPQLAKKKTPK
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001005  SANT/Myb  
CDD cd00167  SANT  
Amino Acid Sequences MDPETPEKSTSAWTDEAKLTEVTPSQFQFLLRVVAQLKEDGRSIKWEKINLPGRTPKSLMHMWAKINKQIAEFETAERDGEPTPVKTPRKRGPQLAKKKTPKAIGLDNGAVDDEFDIKKELLKKRGAEKLGDEEPTAATKRAKVKPEANDDVRVKKESAIQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.29
4 0.27
5 0.25
6 0.21
7 0.19
8 0.2
9 0.18
10 0.2
11 0.19
12 0.19
13 0.19
14 0.19
15 0.19
16 0.18
17 0.19
18 0.15
19 0.18
20 0.17
21 0.17
22 0.18
23 0.18
24 0.18
25 0.16
26 0.18
27 0.16
28 0.16
29 0.22
30 0.25
31 0.28
32 0.31
33 0.33
34 0.33
35 0.41
36 0.49
37 0.43
38 0.46
39 0.47
40 0.47
41 0.47
42 0.47
43 0.39
44 0.35
45 0.34
46 0.33
47 0.31
48 0.31
49 0.31
50 0.36
51 0.36
52 0.34
53 0.35
54 0.32
55 0.27
56 0.25
57 0.23
58 0.22
59 0.21
60 0.18
61 0.16
62 0.15
63 0.15
64 0.13
65 0.13
66 0.08
67 0.09
68 0.1
69 0.09
70 0.11
71 0.18
72 0.24
73 0.27
74 0.35
75 0.41
76 0.51
77 0.54
78 0.61
79 0.65
80 0.7
81 0.78
82 0.79
83 0.82
84 0.79
85 0.82
86 0.79
87 0.72
88 0.66
89 0.59
90 0.55
91 0.49
92 0.44
93 0.38
94 0.32
95 0.27
96 0.23
97 0.18
98 0.12
99 0.09
100 0.07
101 0.06
102 0.07
103 0.08
104 0.08
105 0.11
106 0.19
107 0.25
108 0.3
109 0.36
110 0.4
111 0.46
112 0.54
113 0.54
114 0.49
115 0.46
116 0.46
117 0.44
118 0.41
119 0.34
120 0.26
121 0.25
122 0.26
123 0.23
124 0.19
125 0.17
126 0.21
127 0.3
128 0.36
129 0.41
130 0.45
131 0.52
132 0.58
133 0.67
134 0.7
135 0.65
136 0.67
137 0.66
138 0.65
139 0.61
140 0.55
141 0.46
142 0.4