Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V8U0B8

Protein Details
Accession A0A1V8U0B8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
39-62IKALKEPPRDRKKEKNIKHTKSIPBasic
NLS Segment(s)
PositionSequence
43-56KEPPRDRKKEKNIK
Subcellular Location(s) mito 20, cyto 4.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000911  Ribosomal_L11/L12  
IPR036796  Ribosomal_L11/L12_N_sf  
IPR020783  Ribosomal_L11_C  
IPR036769  Ribosomal_L11_C_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00298  Ribosomal_L11  
Amino Acid Sequences MHIAKATGDWKGLRVTVRLTIKNRQAAVSVVPSASSLVIKALKEPPRDRKKEKNIKHTKSIPLDEIIDIARTMQHKSMAKELQGTVLEILGTAFSTGCQVDGQNPKVVQEKIKAGEIEIPSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.27
4 0.33
5 0.38
6 0.4
7 0.46
8 0.51
9 0.55
10 0.53
11 0.46
12 0.41
13 0.35
14 0.34
15 0.28
16 0.22
17 0.16
18 0.15
19 0.14
20 0.13
21 0.12
22 0.09
23 0.06
24 0.07
25 0.1
26 0.1
27 0.12
28 0.19
29 0.24
30 0.31
31 0.37
32 0.46
33 0.54
34 0.61
35 0.66
36 0.69
37 0.75
38 0.79
39 0.82
40 0.82
41 0.83
42 0.8
43 0.81
44 0.76
45 0.72
46 0.67
47 0.6
48 0.5
49 0.4
50 0.36
51 0.27
52 0.22
53 0.15
54 0.1
55 0.08
56 0.07
57 0.07
58 0.07
59 0.09
60 0.09
61 0.15
62 0.17
63 0.19
64 0.27
65 0.27
66 0.27
67 0.29
68 0.28
69 0.26
70 0.23
71 0.22
72 0.15
73 0.13
74 0.12
75 0.09
76 0.08
77 0.05
78 0.04
79 0.04
80 0.04
81 0.03
82 0.05
83 0.05
84 0.06
85 0.06
86 0.07
87 0.14
88 0.21
89 0.24
90 0.29
91 0.29
92 0.31
93 0.37
94 0.38
95 0.36
96 0.34
97 0.38
98 0.35
99 0.4
100 0.38
101 0.33
102 0.38