Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9NS33

Protein Details
Accession G9NS33    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
200-219EEFYRLKKVANKKQRDNAAAHydrophilic
NLS Segment(s)
PositionSequence
43-44KR
Subcellular Location(s) cyto 17.5, cyto_nucl 13.5, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002699  V_ATPase_D  
Gene Ontology GO:0046961  F:proton-transporting ATPase activity, rotational mechanism  
Pfam View protein in Pfam  
PF01813  ATP-synt_D  
Amino Acid Sequences MSGAADREAVFPTRQSLGIMKAKLKGAETGHSLLKRKSEALTKRFREITRRIDEAKRKMGRVMQIAAFSLAEVSYAVGGDIGYQVQESAKSARFRIRTKQDNVSGVLLPAFESYLTEGNNDFGLTGLGKGGQQVQRCRETYARAVEALVELASLQTAFVILDEVIKVVNRRVNAIEHVIIPRTENTIKYINSELDELDREEFYRLKKVANKKQRDNAAADAEMKAKREAAENNNTGAAADDSGPTDILAAADDDDVIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.2
4 0.25
5 0.31
6 0.33
7 0.33
8 0.35
9 0.38
10 0.38
11 0.36
12 0.34
13 0.3
14 0.3
15 0.32
16 0.31
17 0.33
18 0.36
19 0.38
20 0.35
21 0.37
22 0.35
23 0.33
24 0.34
25 0.38
26 0.43
27 0.48
28 0.57
29 0.56
30 0.6
31 0.64
32 0.63
33 0.62
34 0.6
35 0.61
36 0.57
37 0.59
38 0.57
39 0.6
40 0.66
41 0.65
42 0.67
43 0.62
44 0.57
45 0.55
46 0.55
47 0.52
48 0.47
49 0.44
50 0.36
51 0.32
52 0.31
53 0.28
54 0.23
55 0.17
56 0.12
57 0.08
58 0.06
59 0.05
60 0.04
61 0.04
62 0.04
63 0.04
64 0.03
65 0.03
66 0.03
67 0.04
68 0.04
69 0.04
70 0.03
71 0.04
72 0.04
73 0.05
74 0.06
75 0.09
76 0.14
77 0.15
78 0.17
79 0.24
80 0.29
81 0.32
82 0.41
83 0.47
84 0.51
85 0.54
86 0.6
87 0.59
88 0.56
89 0.54
90 0.47
91 0.37
92 0.29
93 0.24
94 0.16
95 0.11
96 0.08
97 0.06
98 0.04
99 0.04
100 0.05
101 0.06
102 0.07
103 0.07
104 0.07
105 0.08
106 0.08
107 0.07
108 0.06
109 0.05
110 0.05
111 0.04
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.08
118 0.11
119 0.15
120 0.19
121 0.23
122 0.27
123 0.28
124 0.3
125 0.28
126 0.29
127 0.3
128 0.3
129 0.27
130 0.22
131 0.21
132 0.19
133 0.17
134 0.14
135 0.09
136 0.05
137 0.04
138 0.03
139 0.03
140 0.03
141 0.02
142 0.02
143 0.02
144 0.02
145 0.02
146 0.03
147 0.03
148 0.04
149 0.04
150 0.04
151 0.04
152 0.05
153 0.06
154 0.08
155 0.1
156 0.1
157 0.12
158 0.14
159 0.16
160 0.18
161 0.2
162 0.19
163 0.18
164 0.19
165 0.18
166 0.17
167 0.16
168 0.14
169 0.16
170 0.16
171 0.15
172 0.18
173 0.22
174 0.22
175 0.24
176 0.26
177 0.22
178 0.22
179 0.22
180 0.19
181 0.15
182 0.17
183 0.15
184 0.14
185 0.13
186 0.12
187 0.14
188 0.15
189 0.15
190 0.22
191 0.21
192 0.25
193 0.33
194 0.43
195 0.52
196 0.6
197 0.68
198 0.7
199 0.77
200 0.81
201 0.78
202 0.72
203 0.67
204 0.61
205 0.53
206 0.45
207 0.38
208 0.34
209 0.31
210 0.28
211 0.23
212 0.19
213 0.18
214 0.22
215 0.28
216 0.31
217 0.4
218 0.4
219 0.41
220 0.4
221 0.39
222 0.33
223 0.28
224 0.21
225 0.12
226 0.11
227 0.1
228 0.1
229 0.11
230 0.11
231 0.09
232 0.09
233 0.08
234 0.07
235 0.07
236 0.06
237 0.07
238 0.07