Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8ULW2

Protein Details
Accession A0A1V8ULW2    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
20-40NHVFYGKKTKNWKMEKHRICWHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12, pero 10, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
IPR045170  MTOX  
Gene Ontology GO:0050660  F:flavin adenine dinucleotide binding  
GO:0016491  F:oxidoreductase activity  
Amino Acid Sequences PDYGQWEVSEKLREDISYANHVFYGKKTKNWKMEKHRICWDAFTTSADFIISPHAAASGLYVATCGNFHGWKFFPVLGKYIVQMLEGALEPELAQKWAWDRERPKDGKDNADYPRHQMKDFLDPVRQARL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.24
4 0.26
5 0.26
6 0.24
7 0.24
8 0.25
9 0.24
10 0.24
11 0.3
12 0.25
13 0.32
14 0.41
15 0.48
16 0.58
17 0.66
18 0.72
19 0.73
20 0.81
21 0.81
22 0.79
23 0.79
24 0.73
25 0.65
26 0.57
27 0.49
28 0.4
29 0.33
30 0.29
31 0.21
32 0.17
33 0.16
34 0.13
35 0.11
36 0.08
37 0.1
38 0.08
39 0.07
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.05
54 0.05
55 0.06
56 0.09
57 0.1
58 0.1
59 0.12
60 0.13
61 0.15
62 0.15
63 0.17
64 0.16
65 0.16
66 0.15
67 0.15
68 0.14
69 0.11
70 0.1
71 0.08
72 0.07
73 0.07
74 0.07
75 0.05
76 0.05
77 0.05
78 0.06
79 0.07
80 0.06
81 0.06
82 0.07
83 0.11
84 0.18
85 0.21
86 0.28
87 0.33
88 0.41
89 0.52
90 0.54
91 0.56
92 0.58
93 0.6
94 0.61
95 0.61
96 0.6
97 0.55
98 0.61
99 0.57
100 0.54
101 0.59
102 0.52
103 0.47
104 0.44
105 0.42
106 0.44
107 0.49
108 0.46
109 0.42
110 0.43