Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8TYQ5

Protein Details
Accession A0A1V8TYQ5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
158-177QYYEHKPWKRLSFKYNCTPSHydrophilic
NLS Segment(s)
Subcellular Location(s) pero 11.5, cyto_pero 10, cyto 7.5, mito 3, cysk 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002495  Glyco_trans_8  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016757  F:glycosyltransferase activity  
Pfam View protein in Pfam  
PF01501  Glyco_transf_8  
CDD cd02537  GT8_Glycogenin  
Amino Acid Sequences MAVGEDAYCTLVMTDSYLPGAAVLANSLRDCGTTKKLAALDLYDYVIPVDRIGNPNPKNLYLMNRGDLLYTFTKINLWRQTQFRKIVYLDADVVALRAPEELFDTREEFAAAPDVGWPDAFNTGVMVISPHMGTYWALKTLASAGDSFDGADQGLLNQYYEHKPWKRLSFKYNCTPSANY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.1
5 0.09
6 0.09
7 0.09
8 0.06
9 0.05
10 0.06
11 0.06
12 0.08
13 0.08
14 0.09
15 0.08
16 0.09
17 0.11
18 0.15
19 0.19
20 0.22
21 0.22
22 0.26
23 0.27
24 0.27
25 0.26
26 0.23
27 0.2
28 0.18
29 0.18
30 0.13
31 0.12
32 0.11
33 0.11
34 0.09
35 0.07
36 0.08
37 0.09
38 0.12
39 0.16
40 0.25
41 0.26
42 0.31
43 0.33
44 0.32
45 0.32
46 0.3
47 0.32
48 0.3
49 0.31
50 0.27
51 0.26
52 0.25
53 0.23
54 0.22
55 0.2
56 0.14
57 0.13
58 0.12
59 0.11
60 0.13
61 0.14
62 0.2
63 0.23
64 0.25
65 0.28
66 0.33
67 0.39
68 0.43
69 0.47
70 0.41
71 0.38
72 0.35
73 0.34
74 0.29
75 0.24
76 0.19
77 0.14
78 0.13
79 0.1
80 0.09
81 0.07
82 0.05
83 0.04
84 0.04
85 0.03
86 0.03
87 0.06
88 0.07
89 0.08
90 0.09
91 0.11
92 0.11
93 0.11
94 0.11
95 0.09
96 0.09
97 0.1
98 0.08
99 0.07
100 0.08
101 0.08
102 0.08
103 0.07
104 0.07
105 0.06
106 0.07
107 0.07
108 0.06
109 0.05
110 0.06
111 0.06
112 0.05
113 0.05
114 0.04
115 0.05
116 0.05
117 0.05
118 0.05
119 0.06
120 0.06
121 0.09
122 0.1
123 0.11
124 0.11
125 0.11
126 0.12
127 0.13
128 0.14
129 0.11
130 0.1
131 0.09
132 0.1
133 0.1
134 0.1
135 0.08
136 0.07
137 0.06
138 0.06
139 0.05
140 0.05
141 0.08
142 0.08
143 0.08
144 0.08
145 0.12
146 0.16
147 0.19
148 0.29
149 0.32
150 0.38
151 0.46
152 0.56
153 0.61
154 0.65
155 0.72
156 0.73
157 0.76
158 0.8
159 0.8
160 0.74