Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8SYD6

Protein Details
Accession A0A1V8SYD6    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
164-194LADQDEAKRRRNRNKTKKRRNKAKESGTSTPHydrophilic
NLS Segment(s)
PositionSequence
171-187KRRRNRNKTKKRRNKAK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039773  BAG_chaperone_regulator  
IPR036533  BAG_dom_sf  
IPR003103  BAG_domain  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0051087  F:protein-folding chaperone binding  
Pfam View protein in Pfam  
PF02179  BAG  
PROSITE View protein in PROSITE  
PS51035  BAG  
Amino Acid Sequences MSWTSRLSHLGRYSPFTRSPTQNGSTTVSDADFSYITSDDLKRHQEQTAEPTEAEMGPARDTDMLVLSNKGQKYQVHFPAYSMARGELSVGKVREQAGTKLRVDGRRVKMTFKGKTLKDDGRTCRSEGLRDGDHVLCVAGDAPVSGSGSDDEEVDEIDAALGSLADQDEAKRRRNRNKTKKRRNKAKESGTSTPSDAGYLNLPPSQTSRAPSPRPQVPATPQGKIQALRDTLHSFDQDVNQYIRSPSSDRAKREFEHKRLGEVILAQVLLKLDAVETEGDNDARQMRKDLVKETQLVLKNLDDAAARYGATSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.48
3 0.45
4 0.48
5 0.47
6 0.51
7 0.52
8 0.54
9 0.52
10 0.5
11 0.5
12 0.44
13 0.39
14 0.34
15 0.26
16 0.23
17 0.19
18 0.18
19 0.13
20 0.11
21 0.11
22 0.1
23 0.11
24 0.14
25 0.15
26 0.16
27 0.21
28 0.27
29 0.29
30 0.32
31 0.34
32 0.34
33 0.36
34 0.41
35 0.42
36 0.38
37 0.34
38 0.31
39 0.3
40 0.26
41 0.24
42 0.18
43 0.13
44 0.11
45 0.12
46 0.12
47 0.11
48 0.11
49 0.1
50 0.09
51 0.1
52 0.1
53 0.11
54 0.12
55 0.17
56 0.18
57 0.18
58 0.2
59 0.22
60 0.28
61 0.36
62 0.42
63 0.42
64 0.42
65 0.41
66 0.45
67 0.44
68 0.37
69 0.29
70 0.22
71 0.17
72 0.16
73 0.17
74 0.12
75 0.13
76 0.17
77 0.17
78 0.17
79 0.19
80 0.2
81 0.22
82 0.22
83 0.25
84 0.25
85 0.3
86 0.29
87 0.33
88 0.36
89 0.37
90 0.4
91 0.44
92 0.45
93 0.49
94 0.5
95 0.47
96 0.5
97 0.55
98 0.54
99 0.51
100 0.52
101 0.44
102 0.49
103 0.52
104 0.5
105 0.49
106 0.53
107 0.52
108 0.51
109 0.52
110 0.47
111 0.47
112 0.42
113 0.37
114 0.32
115 0.31
116 0.25
117 0.24
118 0.26
119 0.2
120 0.19
121 0.17
122 0.14
123 0.09
124 0.08
125 0.07
126 0.03
127 0.03
128 0.03
129 0.03
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.05
136 0.05
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.04
143 0.03
144 0.03
145 0.03
146 0.02
147 0.02
148 0.02
149 0.02
150 0.02
151 0.02
152 0.03
153 0.03
154 0.04
155 0.12
156 0.15
157 0.23
158 0.31
159 0.39
160 0.49
161 0.6
162 0.71
163 0.75
164 0.83
165 0.87
166 0.92
167 0.95
168 0.96
169 0.96
170 0.94
171 0.94
172 0.93
173 0.91
174 0.89
175 0.86
176 0.8
177 0.71
178 0.63
179 0.53
180 0.44
181 0.33
182 0.25
183 0.17
184 0.12
185 0.11
186 0.1
187 0.1
188 0.1
189 0.1
190 0.1
191 0.12
192 0.15
193 0.15
194 0.17
195 0.23
196 0.3
197 0.35
198 0.41
199 0.46
200 0.47
201 0.5
202 0.5
203 0.48
204 0.45
205 0.5
206 0.47
207 0.42
208 0.38
209 0.37
210 0.38
211 0.35
212 0.32
213 0.28
214 0.27
215 0.26
216 0.29
217 0.27
218 0.26
219 0.26
220 0.24
221 0.19
222 0.18
223 0.21
224 0.2
225 0.21
226 0.2
227 0.19
228 0.2
229 0.19
230 0.19
231 0.18
232 0.18
233 0.21
234 0.31
235 0.36
236 0.41
237 0.46
238 0.51
239 0.5
240 0.58
241 0.62
242 0.58
243 0.62
244 0.58
245 0.55
246 0.52
247 0.51
248 0.42
249 0.33
250 0.28
251 0.18
252 0.17
253 0.13
254 0.12
255 0.11
256 0.1
257 0.08
258 0.07
259 0.05
260 0.05
261 0.07
262 0.07
263 0.07
264 0.09
265 0.11
266 0.11
267 0.11
268 0.13
269 0.16
270 0.18
271 0.19
272 0.2
273 0.25
274 0.31
275 0.35
276 0.39
277 0.42
278 0.44
279 0.45
280 0.45
281 0.47
282 0.46
283 0.44
284 0.4
285 0.34
286 0.3
287 0.27
288 0.26
289 0.19
290 0.15
291 0.17
292 0.16
293 0.14