Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8UL25

Protein Details
Accession A0A1V8UL25    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
170-199RTESEERRRRERRREREERHKREKEKVRAGBasic
NLS Segment(s)
PositionSequence
126-207PYAGAPRSPGKREPPRRPRGMSESSVMDKERDIRRERERADRPPRTESEERRRRERRREREERHKREKEKVRAGAGGARMKK
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013226  Pal1  
Pfam View protein in Pfam  
PF08316  Pal1  
Amino Acid Sequences MAAVMPADKSALNLSSNNPFRNRATSPAAVASTSPRSLEPPAAPPSRDNRMSRNPFLDASELSPLKGDVSGLTSEIFNDLSLLDKDGNGTSVTRAPPPRAGTLPVNGSRQAAPAGSSSRPNGPPPPYAGAPRSPGKREPPRRPRGMSESSVMDKERDIRRERERADRPPRTESEERRRRERRREREERHKREKEKVRAGAGGARMKKPQGLDIIDQLDVTGIYGQGLFHHDGPFDACNPHRNHHKARGPAPMQAFPANSANMALGGSGPLNSRIDLDRFHGRGEEAFEAFTTTRKPQPAVVDPTARAEPVHGEETVGLGTSTFLEGAPASRRDLQRRDSEDVSQMTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.28
3 0.34
4 0.38
5 0.39
6 0.41
7 0.41
8 0.47
9 0.46
10 0.43
11 0.44
12 0.42
13 0.41
14 0.41
15 0.39
16 0.32
17 0.3
18 0.28
19 0.25
20 0.24
21 0.22
22 0.19
23 0.21
24 0.23
25 0.28
26 0.26
27 0.28
28 0.35
29 0.37
30 0.38
31 0.4
32 0.43
33 0.46
34 0.5
35 0.47
36 0.48
37 0.55
38 0.62
39 0.63
40 0.61
41 0.56
42 0.5
43 0.48
44 0.43
45 0.33
46 0.27
47 0.29
48 0.24
49 0.21
50 0.21
51 0.19
52 0.16
53 0.15
54 0.13
55 0.07
56 0.09
57 0.1
58 0.1
59 0.1
60 0.09
61 0.09
62 0.1
63 0.1
64 0.07
65 0.06
66 0.06
67 0.08
68 0.08
69 0.1
70 0.09
71 0.09
72 0.11
73 0.1
74 0.12
75 0.09
76 0.1
77 0.1
78 0.14
79 0.15
80 0.2
81 0.22
82 0.24
83 0.28
84 0.31
85 0.33
86 0.3
87 0.33
88 0.3
89 0.31
90 0.35
91 0.33
92 0.32
93 0.29
94 0.29
95 0.25
96 0.23
97 0.21
98 0.15
99 0.12
100 0.12
101 0.14
102 0.14
103 0.16
104 0.16
105 0.21
106 0.23
107 0.24
108 0.28
109 0.29
110 0.29
111 0.31
112 0.34
113 0.3
114 0.31
115 0.31
116 0.28
117 0.29
118 0.32
119 0.32
120 0.31
121 0.34
122 0.41
123 0.49
124 0.57
125 0.63
126 0.69
127 0.74
128 0.78
129 0.77
130 0.74
131 0.71
132 0.66
133 0.58
134 0.49
135 0.43
136 0.37
137 0.35
138 0.29
139 0.21
140 0.16
141 0.21
142 0.23
143 0.26
144 0.28
145 0.33
146 0.4
147 0.47
148 0.5
149 0.53
150 0.55
151 0.59
152 0.66
153 0.67
154 0.64
155 0.61
156 0.6
157 0.57
158 0.57
159 0.56
160 0.56
161 0.58
162 0.57
163 0.62
164 0.7
165 0.7
166 0.75
167 0.78
168 0.77
169 0.79
170 0.88
171 0.86
172 0.88
173 0.92
174 0.91
175 0.91
176 0.89
177 0.83
178 0.82
179 0.83
180 0.81
181 0.79
182 0.74
183 0.66
184 0.58
185 0.54
186 0.48
187 0.42
188 0.38
189 0.31
190 0.27
191 0.26
192 0.25
193 0.26
194 0.23
195 0.21
196 0.2
197 0.21
198 0.21
199 0.23
200 0.24
201 0.22
202 0.21
203 0.18
204 0.13
205 0.1
206 0.09
207 0.05
208 0.03
209 0.04
210 0.04
211 0.04
212 0.05
213 0.08
214 0.09
215 0.1
216 0.11
217 0.1
218 0.11
219 0.13
220 0.13
221 0.12
222 0.13
223 0.13
224 0.2
225 0.23
226 0.28
227 0.35
228 0.41
229 0.47
230 0.54
231 0.6
232 0.6
233 0.62
234 0.68
235 0.6
236 0.59
237 0.56
238 0.49
239 0.44
240 0.39
241 0.34
242 0.26
243 0.27
244 0.21
245 0.18
246 0.15
247 0.12
248 0.1
249 0.1
250 0.07
251 0.05
252 0.05
253 0.05
254 0.05
255 0.06
256 0.08
257 0.09
258 0.09
259 0.11
260 0.13
261 0.15
262 0.15
263 0.19
264 0.25
265 0.25
266 0.26
267 0.25
268 0.24
269 0.24
270 0.27
271 0.25
272 0.17
273 0.17
274 0.16
275 0.17
276 0.17
277 0.16
278 0.16
279 0.17
280 0.22
281 0.25
282 0.26
283 0.28
284 0.36
285 0.43
286 0.48
287 0.5
288 0.49
289 0.47
290 0.5
291 0.47
292 0.39
293 0.3
294 0.23
295 0.21
296 0.2
297 0.22
298 0.17
299 0.17
300 0.16
301 0.17
302 0.16
303 0.13
304 0.08
305 0.06
306 0.06
307 0.07
308 0.07
309 0.06
310 0.06
311 0.07
312 0.07
313 0.1
314 0.15
315 0.16
316 0.2
317 0.27
318 0.34
319 0.42
320 0.49
321 0.53
322 0.58
323 0.63
324 0.65
325 0.62
326 0.59
327 0.57