Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9NIV4

Protein Details
Accession G9NIV4    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MRKREWKKTLRGVFRRSLKTRBasic
NLS Segment(s)
PositionSequence
3-49KREWKKTLRGVFRRSLKTRLRDRDARNGLYGGGAEGIRRRGEGKKRS
Subcellular Location(s) nucl 17, mito_nucl 14.166, cyto_nucl 10.166, mito 9
Family & Domain DBs
Amino Acid Sequences MRKREWKKTLRGVFRRSLKTRLRDRDARNGLYGGGAEGIRRRGEGKKRSSGSGNSSGRNNESVGRQQYGDGGWNWVRRKRVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.74
4 0.73
5 0.7
6 0.7
7 0.74
8 0.74
9 0.73
10 0.72
11 0.73
12 0.75
13 0.74
14 0.67
15 0.58
16 0.49
17 0.41
18 0.32
19 0.26
20 0.15
21 0.09
22 0.07
23 0.06
24 0.07
25 0.08
26 0.08
27 0.09
28 0.11
29 0.16
30 0.25
31 0.33
32 0.38
33 0.45
34 0.47
35 0.5
36 0.51
37 0.49
38 0.46
39 0.48
40 0.45
41 0.38
42 0.38
43 0.37
44 0.35
45 0.33
46 0.28
47 0.2
48 0.21
49 0.26
50 0.28
51 0.28
52 0.26
53 0.25
54 0.26
55 0.25
56 0.24
57 0.17
58 0.19
59 0.22
60 0.28
61 0.33
62 0.37