Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8V123

Protein Details
Accession A0A1V8V123    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
98-117RPVILKRQWQERMRQGRKKEBasic
NLS Segment(s)
Subcellular Location(s) mito 8plas 8, E.R. 5, mito_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018450  Romo1/Mgr2  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF10247  Romo1  
Amino Acid Sequences MPPVAAAGGMSGPSTFDKLRMGGMMGGTVGLIIGFIFGATNIVRYGPGPNGMMRTLGQYMLGSAATFGFFMSIGTTIRTESSAIMTQAFAAAQANHGRPVILKRQWQERMRQGRKKEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.13
5 0.14
6 0.15
7 0.14
8 0.15
9 0.13
10 0.12
11 0.11
12 0.09
13 0.08
14 0.07
15 0.06
16 0.04
17 0.03
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.04
26 0.04
27 0.05
28 0.05
29 0.05
30 0.05
31 0.06
32 0.08
33 0.08
34 0.1
35 0.1
36 0.1
37 0.12
38 0.12
39 0.13
40 0.11
41 0.12
42 0.11
43 0.1
44 0.09
45 0.07
46 0.07
47 0.07
48 0.06
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.03
56 0.03
57 0.03
58 0.04
59 0.05
60 0.05
61 0.06
62 0.06
63 0.06
64 0.07
65 0.08
66 0.08
67 0.07
68 0.1
69 0.11
70 0.11
71 0.12
72 0.11
73 0.11
74 0.1
75 0.1
76 0.07
77 0.06
78 0.06
79 0.08
80 0.12
81 0.14
82 0.15
83 0.15
84 0.15
85 0.16
86 0.21
87 0.28
88 0.3
89 0.36
90 0.39
91 0.5
92 0.59
93 0.62
94 0.66
95 0.67
96 0.73
97 0.76
98 0.8