Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8V0J2

Protein Details
Accession A0A1V8V0J2    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
68-92AKGGDTKASKKRKAGKKPVQAMQPEHydrophilic
NLS Segment(s)
PositionSequence
33-85PKGKRRGSVEPTRAKGDRRASLQRDAGEASSSGKEAKGGDTKASKKRKAGKKP
Subcellular Location(s) nucl 10.5, mito 9, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDSTQVAQSYLAFAALVGGFGGYYYYTHQRQQPKGKRRGSVEPTRAKGDRRASLQRDAGEASSSGKEAKGGDTKASKKRKAGKKPVQAMQPEEPRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.05
5 0.05
6 0.04
7 0.04
8 0.05
9 0.03
10 0.04
11 0.07
12 0.12
13 0.15
14 0.18
15 0.25
16 0.33
17 0.41
18 0.52
19 0.59
20 0.65
21 0.72
22 0.75
23 0.75
24 0.72
25 0.73
26 0.7
27 0.69
28 0.68
29 0.65
30 0.62
31 0.6
32 0.57
33 0.48
34 0.47
35 0.43
36 0.38
37 0.36
38 0.42
39 0.41
40 0.44
41 0.46
42 0.4
43 0.35
44 0.32
45 0.27
46 0.2
47 0.16
48 0.13
49 0.11
50 0.1
51 0.09
52 0.08
53 0.09
54 0.09
55 0.13
56 0.16
57 0.17
58 0.21
59 0.28
60 0.35
61 0.43
62 0.52
63 0.53
64 0.56
65 0.65
66 0.72
67 0.76
68 0.8
69 0.82
70 0.83
71 0.87
72 0.86
73 0.84
74 0.79
75 0.74
76 0.72