Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8UG93

Protein Details
Accession A0A1V8UG93    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
59-82AAERDTRKKDSKTKRETIFKRAESHydrophilic
NLS Segment(s)
PositionSequence
46-74KKRKSQEKERAEKAAERDTRKKDSKTKRE
Subcellular Location(s) mito 16, nucl 10.5, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012988  Ribosomal_L30_N  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08079  Ribosomal_L30_N  
Amino Acid Sequences MVAQKSTGTKKASTGATKTYVNLIPSLSAGSVPTKDQILVPETLLKKRKSQEKERAEKAAERDTRKKDSKTKRETIFKRAESYVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.38
4 0.38
5 0.36
6 0.34
7 0.3
8 0.26
9 0.23
10 0.19
11 0.15
12 0.14
13 0.14
14 0.1
15 0.07
16 0.07
17 0.08
18 0.08
19 0.08
20 0.09
21 0.09
22 0.09
23 0.09
24 0.1
25 0.11
26 0.11
27 0.11
28 0.15
29 0.16
30 0.21
31 0.26
32 0.26
33 0.28
34 0.33
35 0.42
36 0.45
37 0.54
38 0.6
39 0.65
40 0.73
41 0.72
42 0.72
43 0.65
44 0.61
45 0.55
46 0.54
47 0.5
48 0.48
49 0.52
50 0.53
51 0.6
52 0.63
53 0.66
54 0.67
55 0.72
56 0.75
57 0.77
58 0.8
59 0.8
60 0.84
61 0.83
62 0.82
63 0.82
64 0.75
65 0.71