Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3B1T0

Protein Details
Accession G3B1T0    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
114-142TKEPYYEVYRKKQRCRRLKTIPVQNYQTIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto 8, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
IPR028909  L21p-like  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005840  C:ribosome  
KEGG cten:CANTEDRAFT_104085  -  
Pfam View protein in Pfam  
PF00829  Ribosomal_L21p  
Amino Acid Sequences MANASATNATKSVNPTSSNGITSLKKQVDDMKYLKYDSNGSNSLYAILRLHNIPYLVTKGDKIILPTRMKGVKVGDQLTFNNVTTIGSPNFIFNSENGVNPDLFEIKGSVVEITKEPYYEVYRKKQRCRRLKTIPVQNYQTILMINELKLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.34
4 0.35
5 0.33
6 0.3
7 0.29
8 0.27
9 0.28
10 0.34
11 0.29
12 0.28
13 0.29
14 0.36
15 0.35
16 0.4
17 0.39
18 0.37
19 0.37
20 0.38
21 0.37
22 0.3
23 0.31
24 0.26
25 0.29
26 0.25
27 0.24
28 0.24
29 0.22
30 0.22
31 0.18
32 0.17
33 0.11
34 0.1
35 0.11
36 0.1
37 0.11
38 0.1
39 0.1
40 0.1
41 0.11
42 0.12
43 0.11
44 0.11
45 0.11
46 0.1
47 0.12
48 0.12
49 0.13
50 0.16
51 0.21
52 0.22
53 0.23
54 0.26
55 0.27
56 0.26
57 0.26
58 0.24
59 0.22
60 0.24
61 0.25
62 0.22
63 0.21
64 0.21
65 0.21
66 0.2
67 0.15
68 0.12
69 0.1
70 0.09
71 0.08
72 0.11
73 0.09
74 0.09
75 0.09
76 0.1
77 0.1
78 0.11
79 0.1
80 0.08
81 0.15
82 0.14
83 0.15
84 0.16
85 0.17
86 0.16
87 0.16
88 0.17
89 0.1
90 0.1
91 0.09
92 0.08
93 0.07
94 0.07
95 0.08
96 0.07
97 0.07
98 0.08
99 0.08
100 0.11
101 0.11
102 0.11
103 0.11
104 0.14
105 0.19
106 0.25
107 0.31
108 0.38
109 0.48
110 0.57
111 0.67
112 0.73
113 0.78
114 0.82
115 0.85
116 0.85
117 0.86
118 0.88
119 0.88
120 0.9
121 0.89
122 0.86
123 0.81
124 0.73
125 0.64
126 0.54
127 0.45
128 0.34
129 0.26
130 0.21
131 0.18