Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3B137

Protein Details
Accession G3B137   
Localization Confidence Low
Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
135-160IEVLYKPKKYMPRRKHFYIRNTKYDVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 4, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038657  L19_sf  
IPR001857  Ribosomal_L19  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cten:CANTEDRAFT_120975  -  
Pfam View protein in Pfam  
PF01245  Ribosomal_L19  
Amino Acid Sequences MFTRFTSGLKPLRISVQAIRTFIPTVKASSQTPTVFEPLPSKRNGQSVMKYLHEKLTKKYDPTGKRTALVDQQKGLRSGDIIKVTYLDRTSVVGQIIAIKRSVRNVGTNILLRNKINKLGVEVRIPLYNPKIRNIEVLYKPKKYMPRRKHFYIRNTKYDVGDVEAFLSREKRKQDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.37
3 0.39
4 0.39
5 0.38
6 0.38
7 0.34
8 0.34
9 0.31
10 0.29
11 0.22
12 0.22
13 0.23
14 0.25
15 0.25
16 0.26
17 0.31
18 0.27
19 0.28
20 0.26
21 0.26
22 0.24
23 0.24
24 0.27
25 0.27
26 0.31
27 0.31
28 0.32
29 0.32
30 0.36
31 0.39
32 0.38
33 0.37
34 0.4
35 0.41
36 0.41
37 0.41
38 0.38
39 0.4
40 0.41
41 0.38
42 0.36
43 0.42
44 0.43
45 0.42
46 0.47
47 0.49
48 0.49
49 0.55
50 0.58
51 0.49
52 0.48
53 0.47
54 0.43
55 0.42
56 0.42
57 0.37
58 0.31
59 0.33
60 0.33
61 0.33
62 0.3
63 0.22
64 0.16
65 0.16
66 0.18
67 0.16
68 0.14
69 0.13
70 0.14
71 0.14
72 0.14
73 0.13
74 0.09
75 0.08
76 0.09
77 0.1
78 0.1
79 0.1
80 0.08
81 0.08
82 0.12
83 0.13
84 0.12
85 0.12
86 0.11
87 0.12
88 0.14
89 0.17
90 0.13
91 0.15
92 0.16
93 0.18
94 0.2
95 0.22
96 0.22
97 0.23
98 0.23
99 0.21
100 0.24
101 0.23
102 0.24
103 0.24
104 0.22
105 0.24
106 0.27
107 0.29
108 0.27
109 0.27
110 0.25
111 0.24
112 0.24
113 0.22
114 0.23
115 0.26
116 0.25
117 0.29
118 0.32
119 0.31
120 0.36
121 0.36
122 0.39
123 0.42
124 0.51
125 0.51
126 0.5
127 0.51
128 0.52
129 0.58
130 0.6
131 0.63
132 0.64
133 0.69
134 0.75
135 0.82
136 0.87
137 0.86
138 0.86
139 0.86
140 0.84
141 0.81
142 0.79
143 0.73
144 0.64
145 0.59
146 0.49
147 0.43
148 0.36
149 0.27
150 0.23
151 0.22
152 0.21
153 0.19
154 0.24
155 0.22
156 0.27