Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8UQX1

Protein Details
Accession A0A1V8UQX1    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-27PPRSSGCFTCRRRKIRCDEGRPGCEKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MPPRSSGCFTCRRRKIRCDEGRPGCEKCKTHGVECPGYRKERNGIEFEDQTSLIVQKAKSRHGGKISSDVWKVDSSDGRMIAKPKTTKSAITFALHQEIFSPILQENQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.82
4 0.85
5 0.84
6 0.84
7 0.85
8 0.83
9 0.78
10 0.73
11 0.67
12 0.64
13 0.56
14 0.49
15 0.5
16 0.46
17 0.43
18 0.45
19 0.45
20 0.46
21 0.47
22 0.5
23 0.44
24 0.46
25 0.44
26 0.41
27 0.4
28 0.38
29 0.39
30 0.35
31 0.34
32 0.33
33 0.33
34 0.31
35 0.27
36 0.21
37 0.17
38 0.15
39 0.12
40 0.08
41 0.1
42 0.09
43 0.12
44 0.14
45 0.17
46 0.24
47 0.26
48 0.3
49 0.33
50 0.36
51 0.34
52 0.39
53 0.38
54 0.35
55 0.34
56 0.3
57 0.27
58 0.24
59 0.23
60 0.19
61 0.19
62 0.17
63 0.19
64 0.2
65 0.2
66 0.22
67 0.23
68 0.23
69 0.28
70 0.29
71 0.29
72 0.34
73 0.35
74 0.37
75 0.4
76 0.43
77 0.41
78 0.39
79 0.39
80 0.35
81 0.4
82 0.34
83 0.3
84 0.25
85 0.22
86 0.21
87 0.19
88 0.18