Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8USU3

Protein Details
Accession A0A1V8USU3    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
14-37GESNPRPQYKRWHRPRSLKRMTVEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
Amino Acid Sequences LQRLTQGSPTGLNGESNPRPQYKRWHRPRSLKRMTVELESPFVWPEELGREVLDEKFDKGQMERAERGQEEMQRGMGSDGDTVVDETRRRRMREQAKELLEGRAKWKPVGNPAFGRMSGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.29
4 0.32
5 0.34
6 0.37
7 0.4
8 0.5
9 0.54
10 0.61
11 0.67
12 0.74
13 0.78
14 0.86
15 0.93
16 0.93
17 0.91
18 0.87
19 0.78
20 0.74
21 0.67
22 0.59
23 0.51
24 0.41
25 0.33
26 0.26
27 0.25
28 0.18
29 0.15
30 0.12
31 0.09
32 0.08
33 0.08
34 0.09
35 0.09
36 0.08
37 0.09
38 0.1
39 0.1
40 0.12
41 0.09
42 0.1
43 0.1
44 0.11
45 0.11
46 0.1
47 0.15
48 0.17
49 0.2
50 0.2
51 0.21
52 0.23
53 0.22
54 0.25
55 0.22
56 0.22
57 0.2
58 0.2
59 0.19
60 0.16
61 0.16
62 0.13
63 0.12
64 0.09
65 0.07
66 0.06
67 0.06
68 0.06
69 0.07
70 0.07
71 0.09
72 0.1
73 0.13
74 0.22
75 0.28
76 0.32
77 0.36
78 0.46
79 0.54
80 0.63
81 0.69
82 0.69
83 0.66
84 0.67
85 0.64
86 0.6
87 0.54
88 0.44
89 0.41
90 0.37
91 0.36
92 0.33
93 0.37
94 0.35
95 0.42
96 0.47
97 0.49
98 0.47
99 0.49
100 0.51