Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8TYB5

Protein Details
Accession A0A1V8TYB5    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
62-87GVNNKMTSSKKHRRHSHRHVRHIGDHBasic
NLS Segment(s)
PositionSequence
72-76KHRRH
Subcellular Location(s) nucl 14.5, cyto_nucl 13, cyto 8.5, mito 1, plas 1, extr 1, golg 1
Family & Domain DBs
Amino Acid Sequences MGQVAFPSDLGSGVTPEVAIVRNGQTIYTGKGSQTISSSCQWQNFNPNVNLVGDGTNQGIVGVNNKMTSSKKHRRHSHRHVRHIGDH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.06
3 0.06
4 0.07
5 0.07
6 0.07
7 0.08
8 0.09
9 0.11
10 0.11
11 0.11
12 0.12
13 0.12
14 0.14
15 0.16
16 0.15
17 0.13
18 0.17
19 0.18
20 0.17
21 0.17
22 0.16
23 0.16
24 0.17
25 0.21
26 0.18
27 0.21
28 0.22
29 0.21
30 0.27
31 0.27
32 0.3
33 0.26
34 0.26
35 0.23
36 0.22
37 0.21
38 0.14
39 0.12
40 0.08
41 0.09
42 0.08
43 0.07
44 0.07
45 0.06
46 0.06
47 0.06
48 0.08
49 0.08
50 0.09
51 0.09
52 0.09
53 0.12
54 0.13
55 0.21
56 0.29
57 0.39
58 0.48
59 0.59
60 0.69
61 0.78
62 0.87
63 0.9
64 0.92
65 0.92
66 0.93
67 0.92