Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8UY44

Protein Details
Accession A0A1V8UY44    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
164-185LTVENQKLKRRLKKYEKLHDSHHydrophilic
247-266RRNSLPTPPMHRCRRPGKDPBasic
NLS Segment(s)
Subcellular Location(s) nucl 22, mito_nucl 13.333, cyto_nucl 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR018554  FRQ  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0007623  P:circadian rhythm  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF09421  FRQ  
Amino Acid Sequences MASVNRQPGRVRAPVQRATHLGPKPGNPRRQPSHLSVSLVHNSEDDKSHRSANNSNTSNEDASLVSNKATLSDTPSRLAFLQGKTSSGESSNAEGWFDRSNNQLHRDAAASPYADSDPPFFMRNSSSSQSPPDGSHMLPHRPGLMELGTDGNSNEEYRSVIDDLTVENQKLKRRLKKYEKLHDSHLKDEKLFEIRVHGLPVDKKRELEEMLRNFASNMHAPTTPHSNQWLRRTHPRSTLTRLHHRLRRNSLPTPPMHRCRRPGKDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.62
3 0.6
4 0.58
5 0.55
6 0.58
7 0.52
8 0.5
9 0.45
10 0.49
11 0.55
12 0.59
13 0.64
14 0.63
15 0.69
16 0.7
17 0.74
18 0.72
19 0.68
20 0.69
21 0.63
22 0.59
23 0.52
24 0.51
25 0.48
26 0.43
27 0.37
28 0.28
29 0.25
30 0.23
31 0.24
32 0.21
33 0.2
34 0.21
35 0.27
36 0.29
37 0.33
38 0.38
39 0.42
40 0.49
41 0.48
42 0.47
43 0.45
44 0.45
45 0.41
46 0.35
47 0.27
48 0.18
49 0.16
50 0.18
51 0.14
52 0.11
53 0.12
54 0.11
55 0.11
56 0.12
57 0.11
58 0.15
59 0.21
60 0.23
61 0.24
62 0.24
63 0.24
64 0.23
65 0.26
66 0.24
67 0.19
68 0.25
69 0.23
70 0.24
71 0.24
72 0.25
73 0.22
74 0.18
75 0.19
76 0.13
77 0.15
78 0.16
79 0.15
80 0.14
81 0.14
82 0.14
83 0.14
84 0.14
85 0.13
86 0.13
87 0.17
88 0.21
89 0.25
90 0.26
91 0.24
92 0.25
93 0.25
94 0.22
95 0.19
96 0.17
97 0.13
98 0.1
99 0.11
100 0.11
101 0.1
102 0.1
103 0.1
104 0.1
105 0.11
106 0.12
107 0.11
108 0.11
109 0.12
110 0.14
111 0.17
112 0.17
113 0.17
114 0.17
115 0.19
116 0.2
117 0.19
118 0.18
119 0.16
120 0.16
121 0.14
122 0.18
123 0.19
124 0.19
125 0.19
126 0.19
127 0.17
128 0.16
129 0.16
130 0.13
131 0.1
132 0.08
133 0.07
134 0.08
135 0.08
136 0.08
137 0.07
138 0.07
139 0.07
140 0.07
141 0.07
142 0.06
143 0.06
144 0.06
145 0.08
146 0.08
147 0.07
148 0.07
149 0.08
150 0.08
151 0.11
152 0.12
153 0.1
154 0.13
155 0.16
156 0.22
157 0.3
158 0.37
159 0.43
160 0.5
161 0.61
162 0.68
163 0.75
164 0.8
165 0.83
166 0.84
167 0.78
168 0.79
169 0.77
170 0.7
171 0.68
172 0.64
173 0.55
174 0.46
175 0.44
176 0.39
177 0.33
178 0.3
179 0.23
180 0.2
181 0.22
182 0.22
183 0.22
184 0.2
185 0.19
186 0.24
187 0.31
188 0.34
189 0.32
190 0.32
191 0.34
192 0.37
193 0.36
194 0.37
195 0.39
196 0.36
197 0.4
198 0.4
199 0.37
200 0.34
201 0.32
202 0.29
203 0.23
204 0.2
205 0.18
206 0.19
207 0.19
208 0.22
209 0.29
210 0.27
211 0.27
212 0.32
213 0.36
214 0.42
215 0.5
216 0.55
217 0.53
218 0.63
219 0.66
220 0.66
221 0.68
222 0.68
223 0.66
224 0.66
225 0.69
226 0.66
227 0.72
228 0.73
229 0.74
230 0.73
231 0.76
232 0.78
233 0.78
234 0.8
235 0.76
236 0.75
237 0.74
238 0.75
239 0.72
240 0.72
241 0.72
242 0.71
243 0.74
244 0.75
245 0.76
246 0.79