FuNGI

A0A1V8U649

Protein Details

Accession

A0A1V8U649

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
238-259	LSLTRPKPIRHGRRNPREPTHL	Basic

NLS Segment(s)

Subcellular Location(s)

plas 14, mito 5, E.R. 4, pero 2

Family & Domain DBs

InterPro	View protein in InterPro IPR013969 Oligosacch_biosynth_Alg14
Gene Ontology	GO:0005789 C:endoplasmic reticulum membrane GO:0031965 C:nuclear membrane GO:0006488 P:dolichol-linked oligosaccharide biosynthetic process
Pfam	View protein in Pfam PF08660 Alg14

Amino Acid Sequences

MTRILALPGELRNRIYGFATYQYTPIDVCSHYHQPALSFVNKQFREKALPVFYSVNPVMAKRLEVTSARLARVQKHAKHIQAVEAVSGDELVIAMRTSKENEAHTWVYHHYGDHRMFITRNVAIRTIDNLLRLLGILGEEKDDRFWTSPLPAHTLDFWLSKLGFNVDRTKLTDLTPVIFLAISLFLPAVDVARRSLNHSLSQDLSPRMAYYIRALLITTFLLSLPLTYLLVWRLKYTLSLTRPKPIRHGRRNPREPTHLLIVLGSGGHTAEMIAMLERAVNSPSPQSAQSLDWRDFAHRTWVVGEDDELSATKAKEFEEMATSLTSQETLMRGKVRAYTDHGPGSYDIKKVPRARAIYQSPWTSPFSVLRCFIACWSILTHGVYPEDVSAMQHIPADTKGRDYPDIILVNGPATGTVMVLASVALRFFDYKGAATRFRMRTLYVESWARVKRLSLSGRILAHTVDRCLVQWPLLDAKKTGPGRAEFQGCFV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.29
2	0.28
3	0.25
4	0.22
5	0.25
6	0.28
7	0.25
8	0.26
9	0.25
10	0.24
11	0.21
12	0.2
13	0.18
14	0.15
15	0.17
16	0.22
17	0.28
18	0.29
19	0.31
20	0.29
21	0.28
22	0.32
23	0.35
24	0.32
25	0.3
26	0.34
27	0.42
28	0.44
29	0.46
30	0.45
31	0.44
32	0.48
33	0.47
34	0.5
35	0.46
36	0.45
37	0.45
38	0.45
39	0.41
40	0.4
41	0.37
42	0.33
43	0.26
44	0.26
45	0.26
46	0.22
47	0.23
48	0.18
49	0.19
50	0.19
51	0.2
52	0.24
53	0.29
54	0.32
55	0.32
56	0.35
57	0.36
58	0.37
59	0.46
60	0.5
61	0.46
62	0.52
63	0.58
64	0.58
65	0.63
66	0.59
67	0.54
68	0.49
69	0.44
70	0.35
71	0.28
72	0.24
73	0.17
74	0.16
75	0.1
76	0.05
77	0.05
78	0.04
79	0.04
80	0.04
81	0.05
82	0.06
83	0.08
84	0.1
85	0.14
86	0.18
87	0.2
88	0.23
89	0.28
90	0.29
91	0.28
92	0.28
93	0.26
94	0.27
95	0.25
96	0.23
97	0.2
98	0.26
99	0.26
100	0.27
101	0.27
102	0.25
103	0.25
104	0.26
105	0.28
106	0.23
107	0.25
108	0.24
109	0.24
110	0.23
111	0.23
112	0.24
113	0.23
114	0.21
115	0.18
116	0.17
117	0.15
118	0.14
119	0.13
120	0.11
121	0.07
122	0.06
123	0.06
124	0.06
125	0.07
126	0.08
127	0.08
128	0.09
129	0.1
130	0.12
131	0.12
132	0.13
133	0.13
134	0.16
135	0.2
136	0.21
137	0.24
138	0.23
139	0.22
140	0.22
141	0.23
142	0.2
143	0.18
144	0.16
145	0.14
146	0.13
147	0.13
148	0.13
149	0.14
150	0.14
151	0.16
152	0.22
153	0.22
154	0.24
155	0.26
156	0.28
157	0.26
158	0.24
159	0.26
160	0.21
161	0.2
162	0.19
163	0.16
164	0.14
165	0.12
166	0.11
167	0.07
168	0.07
169	0.05
170	0.04
171	0.04
172	0.04
173	0.04
174	0.04
175	0.04
176	0.05
177	0.05
178	0.06
179	0.09
180	0.09
181	0.13
182	0.18
183	0.19
184	0.23
185	0.23
186	0.24
187	0.24
188	0.25
189	0.24
190	0.2
191	0.19
192	0.15
193	0.14
194	0.13
195	0.12
196	0.11
197	0.09
198	0.11
199	0.1
200	0.1
201	0.1
202	0.09
203	0.1
204	0.09
205	0.07
206	0.05
207	0.05
208	0.05
209	0.05
210	0.05
211	0.04
212	0.05
213	0.05
214	0.04
215	0.05
216	0.07
217	0.09
218	0.1
219	0.09
220	0.1
221	0.1
222	0.11
223	0.13
224	0.17
225	0.2
226	0.27
227	0.28
228	0.35
229	0.39
230	0.39
231	0.46
232	0.49
233	0.55
234	0.58
235	0.68
236	0.72
237	0.79
238	0.87
239	0.85
240	0.8
241	0.76
242	0.68
243	0.6
244	0.53
245	0.43
246	0.34
247	0.27
248	0.21
249	0.14
250	0.12
251	0.08
252	0.04
253	0.03
254	0.03
255	0.03
256	0.03
257	0.02
258	0.03
259	0.03
260	0.03
261	0.03
262	0.03
263	0.03
264	0.04
265	0.04
266	0.05
267	0.05
268	0.06
269	0.07
270	0.08
271	0.09
272	0.09
273	0.1
274	0.11
275	0.13
276	0.18
277	0.22
278	0.23
279	0.23
280	0.24
281	0.24
282	0.24
283	0.23
284	0.24
285	0.2
286	0.19
287	0.18
288	0.2
289	0.19
290	0.18
291	0.17
292	0.11
293	0.11
294	0.11
295	0.1
296	0.08
297	0.09
298	0.09
299	0.09
300	0.09
301	0.09
302	0.11
303	0.11
304	0.12
305	0.13
306	0.13
307	0.13
308	0.13
309	0.13
310	0.11
311	0.1
312	0.09
313	0.07
314	0.07
315	0.08
316	0.09
317	0.12
318	0.13
319	0.14
320	0.15
321	0.2
322	0.21
323	0.22
324	0.27
325	0.29
326	0.31
327	0.33
328	0.31
329	0.28
330	0.27
331	0.29
332	0.25
333	0.22
334	0.21
335	0.22
336	0.3
337	0.34
338	0.39
339	0.42
340	0.44
341	0.46
342	0.53
343	0.55
344	0.54
345	0.55
346	0.52
347	0.46
348	0.44
349	0.43
350	0.35
351	0.31
352	0.3
353	0.27
354	0.27
355	0.27
356	0.26
357	0.24
358	0.23
359	0.22
360	0.18
361	0.16
362	0.13
363	0.13
364	0.14
365	0.14
366	0.15
367	0.15
368	0.15
369	0.15
370	0.14
371	0.13
372	0.11
373	0.1
374	0.09
375	0.08
376	0.09
377	0.09
378	0.1
379	0.11
380	0.11
381	0.11
382	0.13
383	0.18
384	0.16
385	0.19
386	0.22
387	0.24
388	0.26
389	0.26
390	0.27
391	0.29
392	0.3
393	0.26
394	0.24
395	0.2
396	0.19
397	0.17
398	0.15
399	0.07
400	0.07
401	0.06
402	0.05
403	0.05
404	0.05
405	0.05
406	0.05
407	0.05
408	0.05
409	0.05
410	0.05
411	0.05
412	0.06
413	0.07
414	0.07
415	0.11
416	0.11
417	0.13
418	0.2
419	0.24
420	0.27
421	0.31
422	0.4
423	0.4
424	0.43
425	0.43
426	0.39
427	0.39
428	0.44
429	0.43
430	0.39
431	0.4
432	0.37
433	0.43
434	0.44
435	0.41
436	0.34
437	0.31
438	0.32
439	0.36
440	0.41
441	0.39
442	0.42
443	0.46
444	0.47
445	0.47
446	0.42
447	0.34
448	0.35
449	0.3
450	0.26
451	0.23
452	0.21
453	0.2
454	0.22
455	0.22
456	0.18
457	0.18
458	0.2
459	0.27
460	0.3
461	0.31
462	0.3
463	0.31
464	0.39
465	0.39
466	0.39
467	0.37
468	0.37
469	0.4
470	0.46
471	0.49

A0A1V8U649

3D AlphaFold-predicted Structure Viewer