Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V8U1N1

Protein Details
Accession A0A1V8U1N1    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
164-195LADQDEAKRRRNRNKSKKRRNKAKESGTSTPSHydrophilic
NLS Segment(s)
PositionSequence
171-187KRRRNRNKSKKRRNKAK
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
Amino Acid Sequences MSWTSRLSHLGRYSPFTRSPTQNGSTTVSDADFSYITSDDLKRHQEQTAEPTKAELGPARDTDMLVLSNKGQKYQVHFPAYSMARGELSVGKVREQAGSKLRVDGRRVKMTFKGKTLKDDGRTCRSEGLRDGDHVLCVAGDVPVSGSGSDDEEVDEIDAALGSLADQDEAKRRRNRNKSKKRRNKAKESGTSTPSDAGNLNLPPSQTSRAPSPRPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.44
4 0.46
5 0.45
6 0.49
7 0.5
8 0.52
9 0.5
10 0.48
11 0.48
12 0.43
13 0.38
14 0.32
15 0.25
16 0.21
17 0.18
18 0.16
19 0.12
20 0.1
21 0.1
22 0.1
23 0.1
24 0.12
25 0.13
26 0.14
27 0.19
28 0.25
29 0.27
30 0.29
31 0.31
32 0.31
33 0.32
34 0.39
35 0.43
36 0.39
37 0.35
38 0.34
39 0.32
40 0.29
41 0.28
42 0.22
43 0.16
44 0.18
45 0.18
46 0.2
47 0.19
48 0.19
49 0.18
50 0.16
51 0.14
52 0.11
53 0.11
54 0.1
55 0.15
56 0.15
57 0.15
58 0.17
59 0.18
60 0.24
61 0.32
62 0.38
63 0.37
64 0.37
65 0.37
66 0.4
67 0.39
68 0.33
69 0.25
70 0.18
71 0.14
72 0.14
73 0.14
74 0.09
75 0.1
76 0.14
77 0.13
78 0.14
79 0.15
80 0.16
81 0.18
82 0.17
83 0.2
84 0.2
85 0.24
86 0.23
87 0.26
88 0.29
89 0.29
90 0.32
91 0.36
92 0.37
93 0.42
94 0.42
95 0.4
96 0.44
97 0.48
98 0.47
99 0.44
100 0.46
101 0.38
102 0.42
103 0.46
104 0.44
105 0.43
106 0.47
107 0.47
108 0.46
109 0.47
110 0.43
111 0.43
112 0.39
113 0.34
114 0.3
115 0.3
116 0.24
117 0.23
118 0.25
119 0.2
120 0.19
121 0.17
122 0.14
123 0.09
124 0.08
125 0.07
126 0.04
127 0.03
128 0.03
129 0.04
130 0.04
131 0.05
132 0.04
133 0.05
134 0.05
135 0.07
136 0.07
137 0.07
138 0.06
139 0.06
140 0.06
141 0.06
142 0.06
143 0.04
144 0.04
145 0.04
146 0.03
147 0.03
148 0.03
149 0.02
150 0.03
151 0.03
152 0.04
153 0.04
154 0.06
155 0.15
156 0.19
157 0.28
158 0.36
159 0.45
160 0.56
161 0.67
162 0.77
163 0.8
164 0.88
165 0.91
166 0.94
167 0.96
168 0.97
169 0.97
170 0.96
171 0.96
172 0.95
173 0.94
174 0.93
175 0.9
176 0.86
177 0.78
178 0.7
179 0.6
180 0.52
181 0.41
182 0.33
183 0.25
184 0.19
185 0.2
186 0.18
187 0.19
188 0.18
189 0.18
190 0.19
191 0.22
192 0.25
193 0.23
194 0.26
195 0.33
196 0.41