Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8TXX2

Protein Details
Accession A0A1V8TXX2    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
13-36HEKVESKREAKRLKRRNTEVRYEEBasic
NLS Segment(s)
PositionSequence
19-28KREAKRLKRR
Subcellular Location(s) cyto 13.5, cyto_nucl 9, mito 6, nucl 3.5, extr 3
Family & Domain DBs
Amino Acid Sequences MAALIIAGVIALHEKVESKREAKRLKRRNTEVRYEELQKETKLRLERTDSAGGQGRRSESLERERQGEKRGEGLLGYEEVAGSGGRGRAEGVRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.14
4 0.18
5 0.21
6 0.28
7 0.37
8 0.46
9 0.55
10 0.64
11 0.7
12 0.76
13 0.83
14 0.86
15 0.87
16 0.85
17 0.84
18 0.76
19 0.72
20 0.66
21 0.6
22 0.53
23 0.46
24 0.41
25 0.32
26 0.31
27 0.27
28 0.27
29 0.27
30 0.26
31 0.26
32 0.29
33 0.31
34 0.33
35 0.35
36 0.3
37 0.28
38 0.32
39 0.29
40 0.24
41 0.23
42 0.19
43 0.17
44 0.19
45 0.19
46 0.18
47 0.26
48 0.32
49 0.32
50 0.35
51 0.37
52 0.38
53 0.42
54 0.42
55 0.35
56 0.32
57 0.31
58 0.28
59 0.24
60 0.22
61 0.18
62 0.14
63 0.13
64 0.09
65 0.08
66 0.07
67 0.08
68 0.07
69 0.05
70 0.07
71 0.08
72 0.08
73 0.09
74 0.1