Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0QA77

Protein Details
Accession A0A1X0QA77   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
81-108SIISIKKENKPKLKTKKEIKIEKRTFDFHydrophilic
NLS Segment(s)
PositionSequence
85-103IKKENKPKLKTKKEIKIEK
Subcellular Location(s) nucl 12, cyto_nucl 10, cyto 6, E.R. 4, pero 3
Family & Domain DBs
Amino Acid Sequences MIVLTEYELAELLVIIIKLNIILYNKIINYYNQLNACYNIKLINYKKDYLFDESNLINNNLFKNKNIKVKYDKNFIKKLESIISIKKENKPKLKTKKEIKIEKRTFDFKELINKFNQMNEDLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.07
8 0.08
9 0.09
10 0.1
11 0.14
12 0.14
13 0.16
14 0.17
15 0.15
16 0.19
17 0.21
18 0.24
19 0.22
20 0.24
21 0.23
22 0.24
23 0.26
24 0.21
25 0.18
26 0.15
27 0.15
28 0.2
29 0.22
30 0.29
31 0.3
32 0.32
33 0.32
34 0.33
35 0.35
36 0.34
37 0.32
38 0.24
39 0.23
40 0.21
41 0.22
42 0.21
43 0.19
44 0.13
45 0.13
46 0.13
47 0.14
48 0.14
49 0.14
50 0.19
51 0.23
52 0.31
53 0.32
54 0.36
55 0.41
56 0.5
57 0.54
58 0.58
59 0.6
60 0.58
61 0.63
62 0.59
63 0.55
64 0.48
65 0.45
66 0.38
67 0.35
68 0.31
69 0.3
70 0.33
71 0.34
72 0.37
73 0.41
74 0.46
75 0.52
76 0.59
77 0.61
78 0.67
79 0.73
80 0.79
81 0.83
82 0.84
83 0.85
84 0.86
85 0.89
86 0.89
87 0.89
88 0.86
89 0.84
90 0.79
91 0.76
92 0.7
93 0.64
94 0.57
95 0.49
96 0.52
97 0.48
98 0.45
99 0.41
100 0.41
101 0.36
102 0.37
103 0.37