Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0QB21

Protein Details
Accession A0A1X0QB21    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKNINRKKRSGRPKIFNESENHydrophilic
NLS Segment(s)
PositionSequence
6-13RKKRSGRP
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MKNINRKKRSGRPKIFNESENNIIKSKVNKNLKLSSRKLAKEFNVLLNKAVTLRTYRNISNDNKLIIYKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.83
3 0.77
4 0.72
5 0.66
6 0.62
7 0.56
8 0.49
9 0.39
10 0.35
11 0.33
12 0.33
13 0.34
14 0.36
15 0.4
16 0.43
17 0.48
18 0.55
19 0.6
20 0.61
21 0.58
22 0.56
23 0.55
24 0.53
25 0.51
26 0.48
27 0.43
28 0.42
29 0.41
30 0.41
31 0.39
32 0.37
33 0.35
34 0.3
35 0.28
36 0.22
37 0.21
38 0.14
39 0.13
40 0.15
41 0.2
42 0.24
43 0.26
44 0.3
45 0.37
46 0.4
47 0.45
48 0.46
49 0.43
50 0.4