Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9NJM1

Protein Details
Accession G9NJM1    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-37SVCPMPFSPQKQKEEKKNTKRKKKRPFASCPFKTSHydrophilic
NLS Segment(s)
PositionSequence
14-28QKEEKKNTKRKKKRP
Subcellular Location(s) mito 14, mito_nucl 13.333, nucl 10.5, cyto_nucl 7.166
Family & Domain DBs
Amino Acid Sequences MPSVCPMPFSPQKQKEEKKNTKRKKKRPFASCPFKTSSSPPNPPPPLEYFNTDTFKKKSLPISCHWSVPLKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.78
3 0.81
4 0.84
5 0.84
6 0.87
7 0.91
8 0.92
9 0.95
10 0.95
11 0.95
12 0.94
13 0.93
14 0.92
15 0.92
16 0.91
17 0.91
18 0.84
19 0.77
20 0.7
21 0.63
22 0.54
23 0.47
24 0.45
25 0.42
26 0.43
27 0.42
28 0.47
29 0.47
30 0.46
31 0.46
32 0.42
33 0.39
34 0.36
35 0.37
36 0.32
37 0.35
38 0.38
39 0.36
40 0.36
41 0.34
42 0.35
43 0.33
44 0.33
45 0.37
46 0.41
47 0.45
48 0.47
49 0.53
50 0.52
51 0.53
52 0.51