Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0Q9J5

Protein Details
Accession A0A1X0Q9J5    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
165-190YKFKNSSFNKTKKVNLNKKKKRYFFCHydrophilic
NLS Segment(s)
PositionSequence
181-185NKKKK
Subcellular Location(s) nucl 11, cyto_nucl 10.5, mito 8, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR005225  Small_GTP-bd_dom  
IPR001806  Small_GTPase  
Gene Ontology GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
Pfam View protein in Pfam  
PF00071  Ras  
PROSITE View protein in PROSITE  
PS51417  ARF  
PS51419  RAB  
PS51421  RAS  
CDD cd00154  Rab  
Amino Acid Sequences MTNKKYRIVSVGETGVGKSSIINKYINNIFISNISNTIGIDSFTKEVLVDNEVVELRIWDTAGQEKFNSITKSYYRGSHGFIFVFDLSDSEGLNRLERKIEEIKEDTNVQIGILIGNKADLVNEVDENEIKRLSNKLNMNYFICSAKDGFNVNKAFEFLSKEIHYKFKNSSFNKTKKVNLNKKKKRYFFC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.25
3 0.2
4 0.16
5 0.12
6 0.17
7 0.18
8 0.2
9 0.22
10 0.21
11 0.27
12 0.31
13 0.32
14 0.27
15 0.24
16 0.23
17 0.23
18 0.25
19 0.19
20 0.17
21 0.15
22 0.13
23 0.13
24 0.13
25 0.11
26 0.09
27 0.09
28 0.1
29 0.1
30 0.1
31 0.1
32 0.09
33 0.09
34 0.1
35 0.11
36 0.1
37 0.09
38 0.1
39 0.1
40 0.11
41 0.09
42 0.08
43 0.07
44 0.07
45 0.07
46 0.05
47 0.06
48 0.12
49 0.14
50 0.14
51 0.14
52 0.14
53 0.15
54 0.2
55 0.2
56 0.15
57 0.17
58 0.18
59 0.22
60 0.23
61 0.25
62 0.24
63 0.25
64 0.27
65 0.26
66 0.26
67 0.21
68 0.2
69 0.19
70 0.15
71 0.14
72 0.1
73 0.08
74 0.07
75 0.07
76 0.07
77 0.05
78 0.07
79 0.07
80 0.08
81 0.09
82 0.09
83 0.11
84 0.11
85 0.15
86 0.17
87 0.18
88 0.21
89 0.22
90 0.22
91 0.23
92 0.24
93 0.19
94 0.15
95 0.14
96 0.1
97 0.08
98 0.07
99 0.06
100 0.06
101 0.06
102 0.04
103 0.05
104 0.05
105 0.04
106 0.04
107 0.05
108 0.06
109 0.07
110 0.07
111 0.07
112 0.08
113 0.09
114 0.1
115 0.11
116 0.1
117 0.09
118 0.1
119 0.13
120 0.15
121 0.22
122 0.26
123 0.31
124 0.36
125 0.39
126 0.4
127 0.38
128 0.37
129 0.31
130 0.26
131 0.21
132 0.17
133 0.16
134 0.16
135 0.18
136 0.18
137 0.23
138 0.24
139 0.24
140 0.23
141 0.23
142 0.21
143 0.2
144 0.24
145 0.18
146 0.22
147 0.23
148 0.26
149 0.28
150 0.35
151 0.35
152 0.34
153 0.39
154 0.41
155 0.5
156 0.5
157 0.59
158 0.61
159 0.68
160 0.73
161 0.72
162 0.72
163 0.73
164 0.8
165 0.8
166 0.81
167 0.84
168 0.86
169 0.91
170 0.94