Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0QJW0

Protein Details
Accession A0A1X0QJW0    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-28VIKHRGNTYKTKSNRREVRRGPSGKBasic
NLS Segment(s)
PositionSequence
15-30KSNRREVRRGPSGKLT
Subcellular Location(s) nucl 11mito 11mito_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
Amino Acid Sequences MRPVIKHRGNTYKTKSNRREVRRGPSGKLTAIKVGKKGNVHHCHECERPLYSIAALRTAEFSRQKVSARRVSRILGATICGKCVEKKVITTFLEQESKAVSIKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.77
3 0.77
4 0.82
5 0.81
6 0.83
7 0.82
8 0.82
9 0.82
10 0.78
11 0.71
12 0.7
13 0.64
14 0.57
15 0.52
16 0.44
17 0.4
18 0.41
19 0.39
20 0.35
21 0.35
22 0.35
23 0.35
24 0.39
25 0.43
26 0.46
27 0.49
28 0.51
29 0.5
30 0.51
31 0.49
32 0.45
33 0.37
34 0.3
35 0.26
36 0.21
37 0.19
38 0.14
39 0.15
40 0.13
41 0.14
42 0.12
43 0.11
44 0.12
45 0.12
46 0.16
47 0.16
48 0.17
49 0.17
50 0.19
51 0.22
52 0.27
53 0.33
54 0.38
55 0.4
56 0.43
57 0.43
58 0.43
59 0.43
60 0.39
61 0.34
62 0.25
63 0.23
64 0.25
65 0.22
66 0.21
67 0.18
68 0.18
69 0.17
70 0.22
71 0.26
72 0.22
73 0.27
74 0.32
75 0.38
76 0.39
77 0.41
78 0.4
79 0.4
80 0.41
81 0.36
82 0.32
83 0.27
84 0.26