Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0Q6J9

Protein Details
Accession A0A1X0Q6J9    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MKLIKRQTKPKYGNNVKTMTHydrophilic
NLS Segment(s)
PositionSequence
102-107KNKKKK
Subcellular Location(s) nucl 16, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MKLIKRQTKPKYGNNVKTMTVNKTNANLKEDDDYIDKEIKKDEDCEDKEIKEDDDCEDKEEEKCKSKPYLTNAEIRLHNVDTNKDIKIKLPIKEITDALNNKNKKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.76
3 0.67
4 0.65
5 0.59
6 0.54
7 0.5
8 0.44
9 0.39
10 0.41
11 0.46
12 0.42
13 0.42
14 0.36
15 0.3
16 0.3
17 0.29
18 0.25
19 0.21
20 0.2
21 0.19
22 0.23
23 0.21
24 0.19
25 0.21
26 0.21
27 0.2
28 0.2
29 0.22
30 0.26
31 0.28
32 0.32
33 0.31
34 0.29
35 0.3
36 0.28
37 0.25
38 0.17
39 0.15
40 0.12
41 0.15
42 0.15
43 0.15
44 0.15
45 0.16
46 0.17
47 0.2
48 0.21
49 0.23
50 0.24
51 0.26
52 0.3
53 0.34
54 0.38
55 0.4
56 0.48
57 0.44
58 0.49
59 0.48
60 0.49
61 0.45
62 0.41
63 0.38
64 0.29
65 0.29
66 0.23
67 0.22
68 0.21
69 0.23
70 0.22
71 0.22
72 0.22
73 0.22
74 0.3
75 0.34
76 0.34
77 0.39
78 0.41
79 0.42
80 0.45
81 0.43
82 0.37
83 0.4
84 0.39
85 0.39
86 0.44
87 0.46