Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0Q5I7

Protein Details
Accession A0A1X0Q5I7    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MGITRCGRHKKSNSGAKRNKMQKKRKNMMGRQPSNTHydrophilic
NLS Segment(s)
PositionSequence
8-32RHKKSNSGAKRNKMQKKRKNMMGRQ
Subcellular Location(s) nucl 21, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001047  Ribosomal_S8e  
IPR022309  Ribosomal_S8e/biogenesis_NSA2  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01201  Ribosomal_S8e  
Amino Acid Sequences MGITRCGRHKKSNSGAKRNKMQKKRKNMMGRQPSNTKIGETRVKALRVRGGNYKQRALRLNSGEFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.85
3 0.83
4 0.85
5 0.85
6 0.85
7 0.85
8 0.86
9 0.83
10 0.85
11 0.86
12 0.86
13 0.86
14 0.84
15 0.84
16 0.84
17 0.8
18 0.74
19 0.7
20 0.62
21 0.55
22 0.47
23 0.37
24 0.28
25 0.28
26 0.29
27 0.26
28 0.3
29 0.31
30 0.34
31 0.34
32 0.36
33 0.37
34 0.35
35 0.37
36 0.4
37 0.45
38 0.5
39 0.53
40 0.58
41 0.54
42 0.57
43 0.6
44 0.57
45 0.57
46 0.55