Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0QL27

Protein Details
Accession A0A1X0QL27    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MSEIIKYFKLYKKIKKPKYTPLGYEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 8.5, cyto_nucl 7, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029054  dUTPase-like  
IPR036157  dUTPase-like_sf  
Pfam View protein in Pfam  
PF00692  dUTPase  
Amino Acid Sequences MSEIIKYFKLYKKIKKPKYTPLGYEIYSPVNLKLKAGEPYLVPLGFKMSFPKTYCCLLTKNKCRVLGGLIDSDCRGEIRAILCPKEDIFIKRNTIIVVMQILEIDLPVIKENKSNSFIQVGSEVFKINK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.85
3 0.86
4 0.87
5 0.89
6 0.85
7 0.78
8 0.73
9 0.67
10 0.57
11 0.52
12 0.43
13 0.34
14 0.29
15 0.25
16 0.22
17 0.22
18 0.22
19 0.19
20 0.2
21 0.2
22 0.22
23 0.23
24 0.21
25 0.15
26 0.18
27 0.2
28 0.18
29 0.15
30 0.12
31 0.14
32 0.13
33 0.13
34 0.14
35 0.14
36 0.19
37 0.2
38 0.23
39 0.23
40 0.25
41 0.26
42 0.24
43 0.26
44 0.31
45 0.4
46 0.46
47 0.51
48 0.54
49 0.54
50 0.52
51 0.48
52 0.41
53 0.34
54 0.26
55 0.21
56 0.16
57 0.15
58 0.15
59 0.14
60 0.12
61 0.09
62 0.08
63 0.05
64 0.07
65 0.08
66 0.14
67 0.16
68 0.17
69 0.17
70 0.17
71 0.18
72 0.18
73 0.19
74 0.17
75 0.19
76 0.23
77 0.25
78 0.26
79 0.27
80 0.25
81 0.23
82 0.2
83 0.17
84 0.14
85 0.11
86 0.1
87 0.08
88 0.08
89 0.06
90 0.06
91 0.05
92 0.04
93 0.04
94 0.06
95 0.08
96 0.09
97 0.13
98 0.16
99 0.22
100 0.26
101 0.26
102 0.27
103 0.29
104 0.29
105 0.27
106 0.27
107 0.22
108 0.2
109 0.2