Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0Q8X7

Protein Details
Accession A0A1X0Q8X7   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
128-156WYELIKFKKNVHRLKKSNNNKKILRQLIFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 2
Family & Domain DBs
Amino Acid Sequences MIDNATLFLLKNNMKYLLCSNQDSNSAKEDESIQDNNSSELSSLNNTSCNEKIKEDDQPSISTVSDIKSEKDETAKKNSSPKNGSNEISLEMLEYYWSTDLIDDIEESRKNKKDIKQLYFNRYKHHRWYELIKFKKNVHRLKKSNNNKKILRQLIFLLFNKIXXXXDRHCRSQLWLKFILD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.32
4 0.34
5 0.36
6 0.37
7 0.36
8 0.35
9 0.42
10 0.42
11 0.39
12 0.34
13 0.32
14 0.27
15 0.26
16 0.26
17 0.21
18 0.23
19 0.23
20 0.2
21 0.22
22 0.22
23 0.22
24 0.2
25 0.17
26 0.12
27 0.11
28 0.11
29 0.1
30 0.12
31 0.11
32 0.14
33 0.15
34 0.18
35 0.2
36 0.24
37 0.24
38 0.23
39 0.26
40 0.26
41 0.33
42 0.32
43 0.34
44 0.31
45 0.31
46 0.3
47 0.28
48 0.25
49 0.17
50 0.15
51 0.12
52 0.14
53 0.13
54 0.13
55 0.14
56 0.15
57 0.16
58 0.21
59 0.25
60 0.25
61 0.33
62 0.35
63 0.35
64 0.43
65 0.46
66 0.48
67 0.49
68 0.5
69 0.48
70 0.49
71 0.47
72 0.39
73 0.36
74 0.29
75 0.24
76 0.19
77 0.12
78 0.08
79 0.07
80 0.06
81 0.05
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.05
90 0.04
91 0.05
92 0.08
93 0.1
94 0.12
95 0.18
96 0.21
97 0.24
98 0.3
99 0.36
100 0.43
101 0.51
102 0.57
103 0.61
104 0.65
105 0.72
106 0.75
107 0.7
108 0.68
109 0.66
110 0.64
111 0.63
112 0.64
113 0.59
114 0.54
115 0.61
116 0.64
117 0.67
118 0.69
119 0.66
120 0.62
121 0.64
122 0.7
123 0.7
124 0.7
125 0.7
126 0.73
127 0.75
128 0.81
129 0.85
130 0.87
131 0.89
132 0.88
133 0.87
134 0.82
135 0.83
136 0.83
137 0.81
138 0.72
139 0.64
140 0.59
141 0.56
142 0.56
143 0.49
144 0.44
145 0.35
146 0.36
147 0.37
148 0.36
149 0.39
150 0.38
151 0.44
152 0.42
153 0.45
154 0.49
155 0.56
156 0.58
157 0.56