Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0Q9P4

Protein Details
Accession A0A1X0Q9P4    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
125-146LWTLIYRKIKEKRDKKFYKTLIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 10.5, cyto_nucl 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004598  TFIIH_p52/Tfb2  
Gene Ontology GO:0000439  C:transcription factor TFIIH core complex  
GO:0001671  F:ATPase activator activity  
GO:0006289  P:nucleotide-excision repair  
Pfam View protein in Pfam  
PF03849  Tfb2  
Amino Acid Sequences MSRKNMLDHFASNIHICKTHTMKLFLMLLDENCRNFLYENLYNEFKDATDMPLLLGNGHSINCDLKDAFIELNYFNNTVSYNGVDDPAGVEYKNLCKQKFDDFINQEIKTNFSFEFLLLSRLDQLWTLIYRKIKEKRDKKFYKTLIVTLNLPNNKLFSVKKEVININRIVYGSEDEDESEVMKVLNFLKSLGLVYLIKDEEDIKFYTFFEQLYSEVDSSEKSLVLETNFKLYAYSTKSYDLSVLKLFAKILSVIKINSRESFIRGIIDESIIMDSIKNKKINLEQIIDYLYTNARNKNTVLNKNYKSNLIELMRLWVKSRVEKYEGVLIDGFRSYKAYQDALKVIGDELIYKSDEDRTIFISDQVYHKKRSLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.25
4 0.29
5 0.32
6 0.37
7 0.4
8 0.41
9 0.4
10 0.43
11 0.44
12 0.36
13 0.34
14 0.29
15 0.24
16 0.26
17 0.28
18 0.24
19 0.22
20 0.22
21 0.21
22 0.19
23 0.2
24 0.22
25 0.25
26 0.28
27 0.31
28 0.34
29 0.33
30 0.33
31 0.31
32 0.22
33 0.21
34 0.17
35 0.15
36 0.15
37 0.15
38 0.14
39 0.17
40 0.17
41 0.14
42 0.13
43 0.11
44 0.11
45 0.11
46 0.11
47 0.09
48 0.11
49 0.11
50 0.13
51 0.12
52 0.11
53 0.12
54 0.13
55 0.13
56 0.12
57 0.13
58 0.11
59 0.14
60 0.16
61 0.15
62 0.13
63 0.14
64 0.13
65 0.12
66 0.13
67 0.11
68 0.1
69 0.1
70 0.11
71 0.1
72 0.1
73 0.1
74 0.1
75 0.09
76 0.08
77 0.08
78 0.1
79 0.16
80 0.23
81 0.27
82 0.26
83 0.29
84 0.31
85 0.39
86 0.44
87 0.43
88 0.46
89 0.44
90 0.5
91 0.53
92 0.51
93 0.46
94 0.39
95 0.37
96 0.27
97 0.26
98 0.19
99 0.15
100 0.15
101 0.12
102 0.14
103 0.12
104 0.14
105 0.12
106 0.12
107 0.12
108 0.12
109 0.12
110 0.09
111 0.09
112 0.09
113 0.1
114 0.12
115 0.14
116 0.17
117 0.19
118 0.27
119 0.35
120 0.43
121 0.52
122 0.6
123 0.66
124 0.75
125 0.81
126 0.8
127 0.81
128 0.76
129 0.75
130 0.68
131 0.62
132 0.55
133 0.48
134 0.44
135 0.37
136 0.38
137 0.3
138 0.28
139 0.24
140 0.2
141 0.19
142 0.19
143 0.17
144 0.15
145 0.22
146 0.25
147 0.27
148 0.31
149 0.35
150 0.36
151 0.4
152 0.37
153 0.3
154 0.27
155 0.25
156 0.2
157 0.17
158 0.14
159 0.1
160 0.09
161 0.08
162 0.07
163 0.07
164 0.07
165 0.07
166 0.06
167 0.05
168 0.04
169 0.04
170 0.05
171 0.06
172 0.07
173 0.07
174 0.07
175 0.07
176 0.07
177 0.08
178 0.06
179 0.07
180 0.06
181 0.06
182 0.08
183 0.08
184 0.07
185 0.08
186 0.08
187 0.07
188 0.09
189 0.1
190 0.09
191 0.09
192 0.1
193 0.11
194 0.11
195 0.11
196 0.09
197 0.1
198 0.09
199 0.1
200 0.12
201 0.1
202 0.09
203 0.09
204 0.09
205 0.09
206 0.09
207 0.08
208 0.06
209 0.07
210 0.08
211 0.09
212 0.13
213 0.12
214 0.14
215 0.14
216 0.14
217 0.14
218 0.13
219 0.17
220 0.18
221 0.2
222 0.18
223 0.2
224 0.2
225 0.2
226 0.23
227 0.19
228 0.17
229 0.16
230 0.17
231 0.15
232 0.15
233 0.15
234 0.12
235 0.12
236 0.11
237 0.11
238 0.11
239 0.12
240 0.12
241 0.16
242 0.2
243 0.21
244 0.21
245 0.23
246 0.22
247 0.23
248 0.25
249 0.22
250 0.19
251 0.17
252 0.18
253 0.15
254 0.14
255 0.11
256 0.09
257 0.09
258 0.08
259 0.07
260 0.06
261 0.1
262 0.16
263 0.22
264 0.23
265 0.23
266 0.28
267 0.34
268 0.42
269 0.43
270 0.41
271 0.36
272 0.35
273 0.37
274 0.32
275 0.27
276 0.2
277 0.16
278 0.17
279 0.19
280 0.22
281 0.22
282 0.24
283 0.25
284 0.33
285 0.41
286 0.45
287 0.49
288 0.55
289 0.57
290 0.62
291 0.64
292 0.59
293 0.51
294 0.45
295 0.45
296 0.37
297 0.35
298 0.28
299 0.33
300 0.31
301 0.29
302 0.29
303 0.27
304 0.29
305 0.34
306 0.39
307 0.38
308 0.4
309 0.41
310 0.42
311 0.44
312 0.41
313 0.36
314 0.32
315 0.26
316 0.24
317 0.23
318 0.21
319 0.13
320 0.16
321 0.14
322 0.17
323 0.21
324 0.22
325 0.24
326 0.28
327 0.3
328 0.29
329 0.29
330 0.25
331 0.22
332 0.2
333 0.17
334 0.14
335 0.13
336 0.13
337 0.14
338 0.13
339 0.14
340 0.17
341 0.2
342 0.2
343 0.21
344 0.22
345 0.24
346 0.24
347 0.25
348 0.24
349 0.24
350 0.3
351 0.39
352 0.4
353 0.41