Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0QC03

Protein Details
Accession A0A1X0QC03    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
48-76KIPFKRILLKIDRKKKRRADNIEKKHNMGBasic
NLS Segment(s)
PositionSequence
33-72KKKQLQFLKGNVNKAKIPFKRILLKIDRKKKRRADNIEKK
Subcellular Location(s) nucl 18.5, mito_nucl 13, mito 6.5
Family & Domain DBs
Amino Acid Sequences MKKHASKLLEKTLKDLEKFVHEQKPIRDKNNFKKKQLQFLKGNVNKAKIPFKRILLKIDRKKKRRADNIEKKHNMGIYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.45
3 0.36
4 0.35
5 0.39
6 0.4
7 0.38
8 0.37
9 0.4
10 0.45
11 0.53
12 0.52
13 0.54
14 0.56
15 0.59
16 0.67
17 0.74
18 0.73
19 0.67
20 0.72
21 0.7
22 0.72
23 0.71
24 0.68
25 0.61
26 0.6
27 0.66
28 0.59
29 0.62
30 0.53
31 0.48
32 0.42
33 0.4
34 0.44
35 0.36
36 0.38
37 0.36
38 0.39
39 0.45
40 0.46
41 0.51
42 0.51
43 0.59
44 0.64
45 0.7
46 0.76
47 0.74
48 0.81
49 0.83
50 0.84
51 0.84
52 0.85
53 0.86
54 0.87
55 0.91
56 0.92
57 0.88
58 0.8
59 0.73