Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0QCM5

Protein Details
Accession A0A1X0QCM5    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MKENRNIHHLKKKTRFPISKIKKBasic
NLS Segment(s)
Subcellular Location(s) mito 10.5, mito_nucl 10.499, cyto_nucl 9.333, nucl 9, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MKENRNIHHLKKKTRFPISKIKKIILQNEEIGKTASTVPVVLSKAVELFIKEVSTNVYKSLDESDHKITLEKLEAVLNSERYSILLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.82
3 0.78
4 0.81
5 0.8
6 0.8
7 0.75
8 0.68
9 0.63
10 0.62
11 0.64
12 0.56
13 0.5
14 0.44
15 0.43
16 0.41
17 0.35
18 0.3
19 0.21
20 0.18
21 0.15
22 0.12
23 0.08
24 0.07
25 0.07
26 0.09
27 0.09
28 0.09
29 0.08
30 0.08
31 0.08
32 0.08
33 0.08
34 0.05
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.09
41 0.1
42 0.11
43 0.11
44 0.12
45 0.12
46 0.13
47 0.16
48 0.16
49 0.16
50 0.2
51 0.23
52 0.23
53 0.24
54 0.24
55 0.21
56 0.21
57 0.22
58 0.18
59 0.15
60 0.15
61 0.15
62 0.18
63 0.21
64 0.2
65 0.18
66 0.18
67 0.18
68 0.16