Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0Q9S0

Protein Details
Accession A0A1X0Q9S0    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
63-106IKKRLAKKFRSNKPAPEWKRRILGRKFRPNERRRHWRNTKTNVYBasic
NLS Segment(s)
PositionSequence
62-103RKAELIKKRLAKKFRSNKPAPEWKRRILGRKFRPNERRRHWR
Subcellular Location(s) nucl 19, cyto 4, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011501  Noc3_N  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF07540  NOC3p  
PF00832  Ribosomal_L39  
Amino Acid Sequences MDLTRVGDVCEKIINDPEENIELLAKLVEIDDPFILLALGKLFKNICPLYKIXXXXNIMGSRKAELIKKRLAKKFRSNKPAPEWKRRILGRKFRPNERRRHWRNTKTNVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.22
4 0.23
5 0.21
6 0.21
7 0.19
8 0.13
9 0.11
10 0.1
11 0.09
12 0.06
13 0.05
14 0.04
15 0.06
16 0.05
17 0.07
18 0.06
19 0.06
20 0.06
21 0.06
22 0.06
23 0.04
24 0.04
25 0.04
26 0.06
27 0.06
28 0.07
29 0.08
30 0.08
31 0.14
32 0.15
33 0.15
34 0.18
35 0.19
36 0.21
37 0.25
38 0.25
39 0.21
40 0.26
41 0.26
42 0.24
43 0.25
44 0.22
45 0.19
46 0.21
47 0.24
48 0.22
49 0.26
50 0.32
51 0.38
52 0.45
53 0.52
54 0.57
55 0.61
56 0.67
57 0.72
58 0.75
59 0.78
60 0.75
61 0.76
62 0.78
63 0.8
64 0.77
65 0.78
66 0.75
67 0.7
68 0.73
69 0.71
70 0.71
71 0.71
72 0.74
73 0.74
74 0.78
75 0.8
76 0.82
77 0.87
78 0.85
79 0.86
80 0.86
81 0.86
82 0.83
83 0.88
84 0.88
85 0.88
86 0.91