Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0QDB0

Protein Details
Accession A0A1X0QDB0    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
22-49ELEEQEKISRRRRNQKKDYYKPSRGYNNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
Amino Acid Sequences MRKEYIRLEGMTREKKVGVLAELEEQEKISRRRRNQKKDYYKPSRGYNNQKGNIYNDKRNEGMKMIKEVNHIPSKIILNGKIKNQDIDILIDIGEINSFIKDSKEIKGTEFEVSKPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.37
3 0.36
4 0.31
5 0.23
6 0.18
7 0.17
8 0.19
9 0.2
10 0.19
11 0.17
12 0.15
13 0.15
14 0.2
15 0.24
16 0.29
17 0.36
18 0.45
19 0.57
20 0.67
21 0.77
22 0.81
23 0.87
24 0.9
25 0.92
26 0.93
27 0.92
28 0.9
29 0.84
30 0.8
31 0.79
32 0.76
33 0.76
34 0.75
35 0.74
36 0.69
37 0.66
38 0.6
39 0.55
40 0.56
41 0.5
42 0.46
43 0.39
44 0.37
45 0.36
46 0.36
47 0.32
48 0.25
49 0.25
50 0.2
51 0.22
52 0.21
53 0.22
54 0.24
55 0.25
56 0.28
57 0.28
58 0.26
59 0.23
60 0.24
61 0.23
62 0.24
63 0.25
64 0.24
65 0.25
66 0.28
67 0.32
68 0.36
69 0.36
70 0.33
71 0.32
72 0.29
73 0.25
74 0.24
75 0.2
76 0.14
77 0.13
78 0.12
79 0.11
80 0.08
81 0.07
82 0.05
83 0.04
84 0.04
85 0.05
86 0.05
87 0.06
88 0.11
89 0.13
90 0.17
91 0.23
92 0.23
93 0.26
94 0.3
95 0.31
96 0.34
97 0.33