Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0Q8C5

Protein Details
Accession A0A1X0Q8C5   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
54-82NIKDSKFKIVKKKTRKIKKYKNLYSNTVSHydrophilic
NLS Segment(s)
PositionSequence
59-72KFKIVKKKTRKIKK
Subcellular Location(s) mito 12, nucl 11, cyto 2
Family & Domain DBs
Amino Acid Sequences MGMIGCITSLLFCNRNKSIKENNDKIFNNKKENISFKIKENPIRASNLDSITSNIKDSKFKIVKKKTRKIKKYKNLYSNTVSMFIAGLHLNIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.36
3 0.38
4 0.43
5 0.49
6 0.54
7 0.63
8 0.64
9 0.64
10 0.67
11 0.66
12 0.66
13 0.66
14 0.62
15 0.59
16 0.55
17 0.55
18 0.52
19 0.55
20 0.53
21 0.52
22 0.48
23 0.44
24 0.48
25 0.48
26 0.48
27 0.47
28 0.46
29 0.4
30 0.41
31 0.37
32 0.32
33 0.3
34 0.25
35 0.22
36 0.18
37 0.17
38 0.17
39 0.16
40 0.14
41 0.13
42 0.14
43 0.16
44 0.17
45 0.26
46 0.3
47 0.35
48 0.45
49 0.54
50 0.63
51 0.71
52 0.79
53 0.8
54 0.85
55 0.9
56 0.91
57 0.91
58 0.92
59 0.92
60 0.93
61 0.92
62 0.87
63 0.83
64 0.77
65 0.7
66 0.62
67 0.53
68 0.42
69 0.32
70 0.26
71 0.19
72 0.16
73 0.11