Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0QJ42

Protein Details
Accession A0A1X0QJ42    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
83-107IVKVRRNEVRCIRRKPKMTREIELHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto 9.5, cyto_nucl 7, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
Amino Acid Sequences MPVKRANHGKNRNNRGNVSNVSCIKCGAQVPKDKAVSKSSNNAIIEFAAHADLDAASIYQKTDVPVNFIMDYYCISCAVHTGIVKVRRNEVRCIRRKPKMTREIELH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.7
3 0.67
4 0.63
5 0.57
6 0.54
7 0.49
8 0.46
9 0.42
10 0.39
11 0.32
12 0.29
13 0.27
14 0.26
15 0.28
16 0.33
17 0.38
18 0.44
19 0.48
20 0.47
21 0.47
22 0.47
23 0.45
24 0.4
25 0.42
26 0.37
27 0.39
28 0.37
29 0.35
30 0.28
31 0.23
32 0.2
33 0.14
34 0.12
35 0.06
36 0.05
37 0.04
38 0.04
39 0.04
40 0.04
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.04
47 0.05
48 0.05
49 0.09
50 0.09
51 0.13
52 0.14
53 0.16
54 0.15
55 0.15
56 0.14
57 0.11
58 0.12
59 0.09
60 0.09
61 0.07
62 0.07
63 0.07
64 0.08
65 0.09
66 0.11
67 0.1
68 0.12
69 0.18
70 0.26
71 0.31
72 0.32
73 0.39
74 0.44
75 0.47
76 0.54
77 0.59
78 0.62
79 0.66
80 0.75
81 0.77
82 0.79
83 0.85
84 0.87
85 0.87
86 0.87
87 0.84