Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0QDQ4

Protein Details
Accession A0A1X0QDQ4    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
47-67IITDKIKNKDDKPKKIKLSTIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12.333, cyto 5, cyto_mito 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR003593  AAA+_ATPase  
IPR003959  ATPase_AAA_core  
IPR003960  ATPase_AAA_CS  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0016020  C:membrane  
GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
Pfam View protein in Pfam  
PF00004  AAA  
PROSITE View protein in PROSITE  
PS00674  AAA  
CDD cd19481  RecA-like_protease  
Amino Acid Sequences MIKSYKKYKNNQVCFNKLNLNKKDDLIEIKTNELNIKDDEIDKIVNIITDKIKNKDDKPKKIKLSTIATILSIIFTFCCIISYLFPYKSKIINRFEFSKVSDFETQYGILKDKKELHKYSDEIIKINNWISNNNREKLVKIIDPSSFGYMLHGPPGTGKSLFVQALAYLINLKLKMIYLRKNMKLEEIDSITMYSDLSDIITRNKSKVEYLMITPSLINDKYVGESEKNVKQLFKELYDFNDPYTIRIVFFDECEAFFSKRSDKNSRSNSEVCVQTELLTKISQHGENIKGVFLFAATNMPHLIDDAFKRRFGNKCEFEKPKLYSEIIDLIKSVLVELGEEKSDKYAKEVVHVFKNTSQAFITRTCKRYILRNEYGKAIKFDSKSCLKDVRNIQRNERI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.75
3 0.74
4 0.7
5 0.71
6 0.67
7 0.64
8 0.58
9 0.56
10 0.54
11 0.49
12 0.48
13 0.43
14 0.44
15 0.39
16 0.4
17 0.39
18 0.37
19 0.36
20 0.31
21 0.28
22 0.22
23 0.24
24 0.22
25 0.22
26 0.22
27 0.21
28 0.2
29 0.17
30 0.17
31 0.14
32 0.14
33 0.13
34 0.14
35 0.17
36 0.24
37 0.29
38 0.32
39 0.39
40 0.44
41 0.51
42 0.59
43 0.64
44 0.69
45 0.73
46 0.79
47 0.81
48 0.81
49 0.8
50 0.77
51 0.74
52 0.66
53 0.62
54 0.52
55 0.43
56 0.37
57 0.31
58 0.23
59 0.15
60 0.11
61 0.07
62 0.06
63 0.07
64 0.06
65 0.07
66 0.07
67 0.08
68 0.1
69 0.15
70 0.2
71 0.23
72 0.25
73 0.27
74 0.29
75 0.34
76 0.4
77 0.43
78 0.46
79 0.49
80 0.52
81 0.54
82 0.54
83 0.5
84 0.46
85 0.43
86 0.36
87 0.34
88 0.35
89 0.31
90 0.29
91 0.28
92 0.26
93 0.22
94 0.22
95 0.2
96 0.18
97 0.19
98 0.22
99 0.29
100 0.36
101 0.43
102 0.45
103 0.48
104 0.51
105 0.52
106 0.52
107 0.5
108 0.43
109 0.35
110 0.33
111 0.29
112 0.24
113 0.23
114 0.21
115 0.15
116 0.18
117 0.21
118 0.3
119 0.35
120 0.34
121 0.36
122 0.34
123 0.35
124 0.35
125 0.35
126 0.28
127 0.24
128 0.25
129 0.23
130 0.25
131 0.25
132 0.23
133 0.19
134 0.16
135 0.16
136 0.14
137 0.14
138 0.13
139 0.12
140 0.1
141 0.11
142 0.12
143 0.12
144 0.1
145 0.1
146 0.1
147 0.13
148 0.13
149 0.12
150 0.11
151 0.09
152 0.09
153 0.09
154 0.08
155 0.05
156 0.05
157 0.06
158 0.06
159 0.06
160 0.06
161 0.06
162 0.11
163 0.15
164 0.21
165 0.28
166 0.35
167 0.4
168 0.42
169 0.42
170 0.41
171 0.38
172 0.33
173 0.28
174 0.22
175 0.18
176 0.16
177 0.15
178 0.12
179 0.1
180 0.09
181 0.06
182 0.04
183 0.04
184 0.04
185 0.04
186 0.05
187 0.08
188 0.12
189 0.12
190 0.13
191 0.15
192 0.15
193 0.15
194 0.17
195 0.17
196 0.15
197 0.16
198 0.18
199 0.17
200 0.17
201 0.16
202 0.14
203 0.13
204 0.12
205 0.1
206 0.08
207 0.08
208 0.09
209 0.1
210 0.11
211 0.09
212 0.11
213 0.16
214 0.19
215 0.22
216 0.22
217 0.22
218 0.21
219 0.27
220 0.27
221 0.24
222 0.24
223 0.21
224 0.23
225 0.29
226 0.28
227 0.22
228 0.25
229 0.23
230 0.21
231 0.23
232 0.19
233 0.14
234 0.14
235 0.17
236 0.12
237 0.12
238 0.13
239 0.11
240 0.11
241 0.13
242 0.15
243 0.13
244 0.14
245 0.16
246 0.2
247 0.25
248 0.32
249 0.38
250 0.42
251 0.51
252 0.59
253 0.61
254 0.6
255 0.58
256 0.54
257 0.5
258 0.47
259 0.39
260 0.32
261 0.29
262 0.23
263 0.26
264 0.24
265 0.2
266 0.17
267 0.16
268 0.17
269 0.2
270 0.19
271 0.16
272 0.2
273 0.22
274 0.24
275 0.24
276 0.21
277 0.18
278 0.17
279 0.15
280 0.1
281 0.08
282 0.06
283 0.09
284 0.08
285 0.09
286 0.09
287 0.1
288 0.09
289 0.1
290 0.1
291 0.09
292 0.13
293 0.2
294 0.22
295 0.24
296 0.26
297 0.31
298 0.37
299 0.41
300 0.48
301 0.48
302 0.54
303 0.62
304 0.66
305 0.65
306 0.67
307 0.64
308 0.59
309 0.55
310 0.48
311 0.4
312 0.36
313 0.39
314 0.32
315 0.29
316 0.23
317 0.19
318 0.19
319 0.18
320 0.15
321 0.08
322 0.07
323 0.07
324 0.08
325 0.09
326 0.1
327 0.11
328 0.11
329 0.14
330 0.17
331 0.16
332 0.19
333 0.22
334 0.21
335 0.28
336 0.35
337 0.36
338 0.42
339 0.44
340 0.43
341 0.41
342 0.49
343 0.42
344 0.38
345 0.34
346 0.27
347 0.28
348 0.32
349 0.36
350 0.37
351 0.4
352 0.41
353 0.46
354 0.46
355 0.53
356 0.57
357 0.6
358 0.61
359 0.67
360 0.66
361 0.68
362 0.71
363 0.64
364 0.57
365 0.52
366 0.49
367 0.43
368 0.43
369 0.44
370 0.46
371 0.46
372 0.48
373 0.52
374 0.47
375 0.54
376 0.61
377 0.65
378 0.66
379 0.68