Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0QAJ5

Protein Details
Accession A0A1X0QAJ5    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
6-27ATPVVTKRDKLPRKNRFKISAGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto 9.5, cyto_nucl 7, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036853  Ribosomal_L14_sf  
IPR000218  Ribosomal_L14P  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00238  Ribosomal_L14  
Amino Acid Sequences MANKAATPVVTKRDKLPRKNRFKISAGVQTGTRIKNVDNSGVKEVEVIGVIGYRGIMNRLPRASVSDIVVASVKKGKPELKGKIVYALIISQKMVIRRKNGERIAFEDIRSIILDSRGDPRGTGSVNSPVAKEVAEKFARVGSMCSNIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.64
3 0.71
4 0.74
5 0.79
6 0.87
7 0.88
8 0.85
9 0.79
10 0.75
11 0.71
12 0.7
13 0.62
14 0.54
15 0.45
16 0.42
17 0.43
18 0.37
19 0.31
20 0.22
21 0.2
22 0.25
23 0.27
24 0.3
25 0.29
26 0.31
27 0.33
28 0.33
29 0.32
30 0.25
31 0.23
32 0.16
33 0.12
34 0.08
35 0.05
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.05
43 0.07
44 0.09
45 0.13
46 0.14
47 0.14
48 0.14
49 0.18
50 0.19
51 0.18
52 0.17
53 0.15
54 0.15
55 0.14
56 0.15
57 0.11
58 0.09
59 0.13
60 0.12
61 0.11
62 0.14
63 0.17
64 0.22
65 0.31
66 0.36
67 0.38
68 0.4
69 0.4
70 0.41
71 0.38
72 0.31
73 0.24
74 0.2
75 0.14
76 0.12
77 0.12
78 0.1
79 0.11
80 0.16
81 0.21
82 0.23
83 0.27
84 0.34
85 0.4
86 0.48
87 0.52
88 0.52
89 0.49
90 0.5
91 0.53
92 0.47
93 0.4
94 0.34
95 0.28
96 0.24
97 0.22
98 0.18
99 0.11
100 0.12
101 0.12
102 0.11
103 0.16
104 0.18
105 0.18
106 0.17
107 0.18
108 0.2
109 0.21
110 0.21
111 0.19
112 0.23
113 0.27
114 0.28
115 0.26
116 0.23
117 0.22
118 0.21
119 0.21
120 0.17
121 0.21
122 0.22
123 0.22
124 0.22
125 0.24
126 0.25
127 0.23
128 0.22
129 0.18