Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0Q9E7

Protein Details
Accession A0A1X0Q9E7    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MKKLQTKNTKKNNLKKSKTIVKRKVTTHydrophilic
NLS Segment(s)
PositionSequence
10-26KKNNLKKSKTIVKRKVT
Subcellular Location(s) nucl 16, mito 8, cyto 3
Family & Domain DBs
Amino Acid Sequences MKKLQTKNTKKNNLKKSKTIVKRKVTTAPKTTKSKSDKNIISKPPEDFYTKLYRAFNDSTSNNEDDNDYLDFIRIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.85
3 0.84
4 0.83
5 0.83
6 0.84
7 0.83
8 0.82
9 0.8
10 0.76
11 0.76
12 0.74
13 0.71
14 0.69
15 0.67
16 0.65
17 0.66
18 0.64
19 0.63
20 0.61
21 0.62
22 0.58
23 0.58
24 0.57
25 0.58
26 0.63
27 0.59
28 0.58
29 0.52
30 0.49
31 0.42
32 0.38
33 0.34
34 0.27
35 0.26
36 0.3
37 0.29
38 0.31
39 0.31
40 0.3
41 0.32
42 0.33
43 0.31
44 0.28
45 0.28
46 0.29
47 0.32
48 0.33
49 0.28
50 0.27
51 0.25
52 0.2
53 0.22
54 0.18
55 0.14
56 0.13