Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0Q6X2

Protein Details
Accession A0A1X0Q6X2    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
108-127RSFHKRCLEVFKNKRHNTKYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, mito 9, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
IPR038717  Tc1-like_DDE_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF13358  DDE_3  
Amino Acid Sequences MTAGVLKQILAQNLNVAAREIGLDEYIFMHDNDPKHTSRLVTDWINEKNIDVLDWPIQSPDLNPIEAVWAYVKTKLSKFGKLNKNELREKIKEIWCRIPNDSVFKYVRSFHKRCLEVFKNKRHNTKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.17
3 0.15
4 0.12
5 0.11
6 0.11
7 0.1
8 0.08
9 0.07
10 0.07
11 0.06
12 0.07
13 0.08
14 0.09
15 0.08
16 0.09
17 0.12
18 0.13
19 0.17
20 0.2
21 0.2
22 0.21
23 0.22
24 0.21
25 0.2
26 0.22
27 0.23
28 0.21
29 0.22
30 0.25
31 0.26
32 0.27
33 0.25
34 0.22
35 0.19
36 0.17
37 0.15
38 0.1
39 0.09
40 0.09
41 0.1
42 0.1
43 0.08
44 0.09
45 0.08
46 0.08
47 0.12
48 0.11
49 0.11
50 0.11
51 0.1
52 0.11
53 0.11
54 0.11
55 0.06
56 0.06
57 0.07
58 0.09
59 0.11
60 0.12
61 0.13
62 0.21
63 0.24
64 0.31
65 0.35
66 0.43
67 0.5
68 0.53
69 0.62
70 0.6
71 0.64
72 0.62
73 0.63
74 0.6
75 0.54
76 0.54
77 0.53
78 0.54
79 0.54
80 0.54
81 0.57
82 0.55
83 0.57
84 0.54
85 0.52
86 0.48
87 0.49
88 0.46
89 0.42
90 0.38
91 0.36
92 0.36
93 0.35
94 0.42
95 0.44
96 0.45
97 0.48
98 0.57
99 0.57
100 0.58
101 0.63
102 0.62
103 0.64
104 0.7
105 0.72
106 0.74
107 0.79