Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0QAM0

Protein Details
Accession A0A1X0QAM0    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
21-44LLKLIQERQKKQNKSKKPFKLLAAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 5, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR023391  Prot_translocase_SecE_dom_sf  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSSNLNSHLKTIKSKESNPDLLKLIQERQKKQNKSKKPFKLLAALLLYPMLAKTFLQNLKKPKIGESLQVLRLFSIVAILLGLLCYVIKVFYIPINNILIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.56
3 0.59
4 0.65
5 0.59
6 0.58
7 0.5
8 0.45
9 0.43
10 0.37
11 0.36
12 0.34
13 0.39
14 0.41
15 0.48
16 0.57
17 0.63
18 0.71
19 0.75
20 0.79
21 0.82
22 0.87
23 0.87
24 0.85
25 0.82
26 0.74
27 0.72
28 0.61
29 0.56
30 0.47
31 0.37
32 0.28
33 0.22
34 0.19
35 0.11
36 0.1
37 0.05
38 0.03
39 0.03
40 0.04
41 0.1
42 0.15
43 0.19
44 0.24
45 0.3
46 0.35
47 0.39
48 0.39
49 0.36
50 0.38
51 0.36
52 0.36
53 0.36
54 0.37
55 0.38
56 0.39
57 0.36
58 0.29
59 0.27
60 0.22
61 0.15
62 0.1
63 0.05
64 0.04
65 0.04
66 0.04
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.04
76 0.04
77 0.06
78 0.1
79 0.14
80 0.15
81 0.19