Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0QDI2

Protein Details
Accession A0A1X0QDI2    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
29-59NLENVAPKKKRERKKRDETTRRNVNRKNVNLHydrophilic
212-233QFEYTYKRTQRKCKVFLNINHIHydrophilic
NLS Segment(s)
PositionSequence
35-47PKKKRERKKRDET
Subcellular Location(s) nucl 22.5, cyto_nucl 12.833, cyto_mito 2.833, mito 2.5
Family & Domain DBs
Amino Acid Sequences MENEFNKITTSNDKKIKFIEEDSVYNYENLENVAPKKKRERKKRDETTRRNVNRKNVNLPASQPYVKIIDGEEKMAFKYNTRLSESALSQIPKESIVEDEFTIYFNVESVDITSLNEKFKMDNCVYPRANVPIERYAGNRWSYETECNKLAWQLVSLNSSILYGRKGLIQRAVDSYRYLTKSCKGSKYYRNELFNGEIEKRKKISNLQSVGQFEYTYKRTQRKCKVFLNINHIDFDQINDKTKSKYSVFVEDYDENSFXXXXVKFFLTLITLILIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.53
3 0.56
4 0.5
5 0.45
6 0.45
7 0.41
8 0.41
9 0.42
10 0.42
11 0.36
12 0.31
13 0.29
14 0.2
15 0.16
16 0.15
17 0.13
18 0.14
19 0.18
20 0.27
21 0.3
22 0.36
23 0.47
24 0.56
25 0.64
26 0.71
27 0.78
28 0.8
29 0.88
30 0.93
31 0.93
32 0.95
33 0.95
34 0.94
35 0.94
36 0.92
37 0.91
38 0.86
39 0.85
40 0.83
41 0.79
42 0.77
43 0.73
44 0.68
45 0.6
46 0.57
47 0.52
48 0.47
49 0.42
50 0.34
51 0.29
52 0.26
53 0.24
54 0.21
55 0.17
56 0.18
57 0.18
58 0.2
59 0.19
60 0.17
61 0.18
62 0.22
63 0.21
64 0.15
65 0.22
66 0.24
67 0.27
68 0.31
69 0.31
70 0.29
71 0.33
72 0.33
73 0.29
74 0.27
75 0.24
76 0.2
77 0.2
78 0.18
79 0.14
80 0.14
81 0.11
82 0.1
83 0.1
84 0.11
85 0.1
86 0.11
87 0.1
88 0.11
89 0.1
90 0.08
91 0.07
92 0.06
93 0.06
94 0.05
95 0.05
96 0.05
97 0.06
98 0.06
99 0.06
100 0.08
101 0.09
102 0.1
103 0.11
104 0.1
105 0.1
106 0.12
107 0.18
108 0.17
109 0.21
110 0.23
111 0.3
112 0.3
113 0.3
114 0.29
115 0.27
116 0.27
117 0.24
118 0.24
119 0.19
120 0.2
121 0.2
122 0.2
123 0.19
124 0.21
125 0.21
126 0.18
127 0.16
128 0.18
129 0.18
130 0.23
131 0.25
132 0.23
133 0.23
134 0.23
135 0.22
136 0.2
137 0.2
138 0.13
139 0.12
140 0.1
141 0.1
142 0.11
143 0.11
144 0.1
145 0.09
146 0.09
147 0.08
148 0.07
149 0.07
150 0.06
151 0.07
152 0.11
153 0.12
154 0.13
155 0.18
156 0.19
157 0.2
158 0.24
159 0.26
160 0.23
161 0.22
162 0.23
163 0.23
164 0.24
165 0.23
166 0.21
167 0.24
168 0.31
169 0.36
170 0.4
171 0.4
172 0.47
173 0.55
174 0.61
175 0.66
176 0.66
177 0.64
178 0.59
179 0.57
180 0.52
181 0.45
182 0.4
183 0.34
184 0.33
185 0.31
186 0.34
187 0.33
188 0.32
189 0.33
190 0.37
191 0.44
192 0.47
193 0.49
194 0.48
195 0.52
196 0.52
197 0.5
198 0.42
199 0.32
200 0.23
201 0.25
202 0.24
203 0.24
204 0.29
205 0.36
206 0.44
207 0.54
208 0.64
209 0.69
210 0.75
211 0.77
212 0.8
213 0.81
214 0.8
215 0.79
216 0.76
217 0.67
218 0.61
219 0.52
220 0.44
221 0.35
222 0.3
223 0.28
224 0.21
225 0.26
226 0.27
227 0.29
228 0.3
229 0.34
230 0.37
231 0.32
232 0.38
233 0.37
234 0.43
235 0.44
236 0.43
237 0.46
238 0.42
239 0.42
240 0.38
241 0.34
242 0.24
243 0.22
244 0.2
245 0.14
246 0.12
247 0.1
248 0.07
249 0.08
250 0.1
251 0.1
252 0.1