Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0Q776

Protein Details
Accession A0A1X0Q776    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
48-74ASLKASRRRQGKKTYIKKEIKKSHTGYHydrophilic
NLS Segment(s)
PositionSequence
43-69KRRSPASLKASRRRQGKKTYIKKEIKK
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR018267  Ribosomal_L37e_CS  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
PROSITE View protein in PROSITE  
PS01077  RIBOSOMAL_L37E  
Amino Acid Sequences MTKGTPSFGKRVKRNHLLCPRCGSMSYHKQKMKCSSCAFPEAKRRSPASLKASRRRQGKKTYIKKEIKKSHTGYLQHPILMKFHAERSYQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.75
3 0.79
4 0.75
5 0.72
6 0.69
7 0.61
8 0.52
9 0.49
10 0.42
11 0.4
12 0.46
13 0.49
14 0.51
15 0.52
16 0.54
17 0.59
18 0.65
19 0.62
20 0.58
21 0.55
22 0.5
23 0.49
24 0.54
25 0.49
26 0.44
27 0.48
28 0.47
29 0.47
30 0.47
31 0.45
32 0.42
33 0.44
34 0.47
35 0.45
36 0.48
37 0.51
38 0.57
39 0.65
40 0.67
41 0.73
42 0.72
43 0.72
44 0.73
45 0.75
46 0.77
47 0.78
48 0.81
49 0.82
50 0.85
51 0.86
52 0.86
53 0.86
54 0.82
55 0.8
56 0.75
57 0.72
58 0.7
59 0.66
60 0.59
61 0.58
62 0.53
63 0.46
64 0.45
65 0.38
66 0.32
67 0.29
68 0.28
69 0.21
70 0.24